Names & Taxonomy

Uniprot ID:
P05412
Entry Name:
JUN_HUMAN
Status:
reviewed
Protein Names:
Transcription factor AP-1 (Activator protein 1) (AP1) (Proto-oncogene c-Jun) (V-jun avian sarcoma virus 17 oncogene homolog) (p39)
Gene Names:
JUN
Gene Names Primary:
JUN
Organism:
Homo sapiens (Human)

Structure

Length:
331
Sequence:
MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
Proteomes:
UP000005640

Subcellular location

Subcellular Location:
Nucleus.

Function

Function:
Transcription factor that recognizes and binds to the enhancer heptamer motif 5'-TGATCA-3'. Promotes activity of NR5A1 when phosphorylated by HIPK3 leading to increased steroidogenic gene expression upon cAMP signaling pathway stimulation. Involved in activated KRAS-mediated transcriptional activation of USP28 in colorectal cancer (CRC) cells (PubMed:24623306). Binds to the USP28 promoter in colorectal cancer (CRC) cells (PubMed:24623306).
Cross Reference Drug Bank:
DB01169 DB01029 DB00852 DB00570
Gene Ontology Go:
cytosol
nuclear chromosome
nuclear euchromatin
nucleoplasm
nucleus
transcription factor complex
transcriptional repressor complex
cAMP response element binding
chromatin binding
DNA binding
enzyme binding
GTPase activator activity
identical protein binding
poly(A) RNA binding
R-SMAD binding
RNA polymerase II activating transcription factor binding
RNA polymerase II core promoter proximal region sequence-specific DNA binding
RNA polymerase II distal enhancer sequence-specific DNA binding
RNA polymerase II transcription factor activity, sequence-specific DNA binding
transcription coactivator activity
transcription factor activity, RNA polymerase II core promoter proximal region sequence-specific binding
transcription factor activity, RNA polymerase II distal enhancer sequence-specific binding
transcription factor activity, sequence-specific DNA binding
transcription factor binding
transcription regulatory region DNA binding
transcriptional activator activity, RNA polymerase II core promoter proximal region sequence-specific binding
transcriptional activator activity, RNA polymerase II transcription factor binding
aging
angiogenesis
axon regeneration
cellular response to calcium ion
cellular response to hormone stimulus
cellular response to potassium ion starvation
circadian rhythm
eyelid development in camera-type eye
Fc-epsilon receptor signaling pathway
innate immune response
leading edge cell differentiation
learning
liver development
membrane depolarization
microglial cell activation
monocyte differentiation
MyD88-dependent toll-like receptor signaling pathway
MyD88-independent toll-like receptor signaling pathway
negative regulation by host of viral transcription
negative regulation of cell proliferation
negative regulation of DNA binding
negative regulation of neuron apoptotic process
negative regulation of protein autophosphorylation
negative regulation of transcription from RNA polymerase II promoter in response to endoplasmic reticulum stress
negative regulation of transcription, DNA-templated
outflow tract morphogenesis
positive regulation by host of viral transcription
positive regulation of cell differentiation
positive regulation of DNA replication
positive regulation of DNA-templated transcription, initiation
positive regulation of endothelial cell proliferation
positive regulation of epithelial cell migration
positive regulation of ERK1 and ERK2 cascade
positive regulation of fibroblast proliferation
positive regulation of GTPase activity
positive regulation of monocyte differentiation
positive regulation of neuron apoptotic process
positive regulation of pri-miRNA transcription from RNA polymerase II promoter
positive regulation of smooth muscle cell proliferation
positive regulation of transcription from RNA polymerase II promoter
positive regulation of transcription, DNA-templated
Ras protein signal transduction
regulation of cell cycle
regulation of cell death
regulation of cell proliferation
regulation of sequence-specific DNA binding transcription factor activity
release of cytochrome c from mitochondria
response to cAMP
response to cytokine
response to drug
response to hydrogen peroxide
response to lipopolysaccharide
response to mechanical stimulus
response to muscle stretch
response to radiation
SMAD protein import into nucleus
SMAD protein signal transduction
stress-activated MAPK cascade
toll-like receptor 10 signaling pathway
toll-like receptor 2 signaling pathway
toll-like receptor 3 signaling pathway
toll-like receptor 4 signaling pathway
toll-like receptor 5 signaling pathway
toll-like receptor 9 signaling pathway
toll-like receptor signaling pathway
toll-like receptor TLR1:TLR2 signaling pathway
toll-like receptor TLR6:TLR2 signaling pathway
transforming growth factor beta receptor signaling pathway
TRIF-dependent toll-like receptor signaling pathway
Gene Ontology Biological Process:
aging
angiogenesis
axon regeneration
cellular response to calcium ion
cellular response to hormone stimulus
cellular response to potassium ion starvation
circadian rhythm
eyelid development in camera-type eye
Fc-epsilon receptor signaling pathway
innate immune response
leading edge cell differentiation
learning
liver development
membrane depolarization
microglial cell activation
monocyte differentiation
MyD88-dependent toll-like receptor signaling pathway
MyD88-independent toll-like receptor signaling pathway
negative regulation by host of viral transcription
negative regulation of cell proliferation
negative regulation of DNA binding
negative regulation of neuron apoptotic process
negative regulation of protein autophosphorylation
negative regulation of transcription, DNA-templated
negative regulation of transcription from RNA polymerase II promoter in response to endoplasmic reticulum stress
outflow tract morphogenesis
positive regulation by host of viral transcription
positive regulation of cell differentiation
positive regulation of DNA replication
positive regulation of DNA-templated transcription, initiation
positive regulation of endothelial cell proliferation
positive regulation of epithelial cell migration
positive regulation of ERK1 and ERK2 cascade
positive regulation of fibroblast proliferation
positive regulation of GTPase activity
positive regulation of monocyte differentiation
positive regulation of neuron apoptotic process
positive regulation of pri-miRNA transcription from RNA polymerase II promoter
positive regulation of smooth muscle cell proliferation
positive regulation of transcription, DNA-templated
positive regulation of transcription from RNA polymerase II promoter
Ras protein signal transduction
regulation of cell cycle
regulation of cell death
regulation of cell proliferation
regulation of sequence-specific DNA binding transcription factor activity
release of cytochrome c from mitochondria
response to cAMP
response to cytokine
response to drug
response to hydrogen peroxide
response to lipopolysaccharide
response to mechanical stimulus
response to muscle stretch
response to radiation
SMAD protein import into nucleus
SMAD protein signal transduction
stress-activated MAPK cascade
toll-like receptor 10 signaling pathway
toll-like receptor 2 signaling pathway
toll-like receptor 3 signaling pathway
toll-like receptor 4 signaling pathway
toll-like receptor 5 signaling pathway
toll-like receptor 9 signaling pathway
toll-like receptor signaling pathway
toll-like receptor TLR1:TLR2 signaling pathway
toll-like receptor TLR6:TLR2 signaling pathway
transforming growth factor beta receptor signaling pathway
TRIF-dependent toll-like receptor signaling pathway
Gene Ontology Molecular Function:
cAMP response element binding
chromatin binding
DNA binding
enzyme binding
GTPase activator activity
identical protein binding
poly(A) RNA binding
RNA polymerase II activating transcription factor binding
RNA polymerase II core promoter proximal region sequence-specific DNA binding
RNA polymerase II distal enhancer sequence-specific DNA binding
RNA polymerase II transcription factor activity, sequence-specific DNA binding
R-SMAD binding
transcriptional activator activity, RNA polymerase II core promoter proximal region sequence-specific binding
transcriptional activator activity, RNA polymerase II transcription factor binding
transcription coactivator activity
transcription factor activity, RNA polymerase II core promoter proximal region sequence-specific binding
transcription factor activity, RNA polymerase II distal enhancer sequence-specific binding
transcription factor activity, sequence-specific DNA binding
transcription factor binding
transcription regulatory region DNA binding
Gene Ontology Cellular Component:
cytosol
nuclear chromosome
nuclear euchromatin
nucleoplasm
nucleus
transcriptional repressor complex
transcription factor complex
Keywords:
3D-structure
Acetylation
Activator
Complete proteome
DNA-binding
Direct protein sequencing
Nucleus
Phosphoprotein
Polymorphism
Proto-oncogene
Reference proteome
Transcription
Transcription regulation
Ubl conjugation
Interacts With:
Itself; Q06481; P05067; P18846; P15336; P18847; P18848; P17544; Q16520; Q9NR55; Q8IWZ6; Q99966; O43889; P14921; P01100; P15407; P15408; Q9HD26; P0C746; P07900; P11142; Q8WQG9; P52292; P53779; P45983; P45983-1; Q9UPY8; P56671; Q00987; Q9DGW5; P07197; O95644; Q13469-2; P48634; Q15796; Q9NRL3; Q71U36; P07437; Q99986

Publication

PubMed ID:
3194415 2825349 16710414 15489334 1846781 8464713 8855261 8663478 8837781 9732876 10196196 10376527 10995748 11689449 12087103 15467742 14739463 17210646 16478997 17804415 18650425 18669648 19413330 19690332 20852630 20068231 21177766 21406692 22307329 23624934 24623306 7816143 8662824