Names & Taxonomy
- Uniprot ID:
- P05089
- Entry Name:
- ARGI1_HUMAN
- Status:
- reviewed
- Protein Names:
- Arginase-1 (EC 3.5.3.1) (Liver-type arginase) (Type I arginase)
- Gene Names:
- ARG1
- Gene Names Primary:
- ARG1
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 322
- Sequence:
- MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Cytoplasm
Function
- Pathway:
- Nitrogen metabolism; urea cycle; L-ornithine and urea from L-arginine: step 1/1.
- Catalytic Activity:
- L-arginine + H(2)O = L-ornithine + urea.
- Cofactor:
- COFACTOR: Name=Mn(2+); Xref=ChEBI:CHEBI:29035;
- Cross Reference Drug Bank:
- DB00129 DB03904
- Gene Ontology Go:
- cytoplasm
cytosol
extracellular exosome
extracellular space
mitochondrial outer membrane
neuron projection
neuronal cell body
nucleus
arginase activity
manganese ion binding
aging
arginine catabolic process
arginine catabolic process to ornithine
cellular nitrogen compound metabolic process
cellular response to dexamethasone stimulus
cellular response to glucagon stimulus
cellular response to hydrogen peroxide
cellular response to interleukin-4
cellular response to lipopolysaccharide
cellular response to transforming growth factor beta stimulus
collagen biosynthetic process
liver development
lung development
mammary gland involution
maternal process involved in female pregnancy
polyamine metabolic process
positive regulation of endothelial cell proliferation
protein homotrimerization
regulation of L-arginine import
response to amine
response to amino acid
response to axon injury
response to cadmium ion
response to drug
response to herbicide
response to manganese ion
response to methylmercury
response to selenium ion
response to vitamin A
response to vitamin E
response to zinc ion
small molecule metabolic process
urea cycle - Gene Ontology Biological Process:
- aging
arginine catabolic process
arginine catabolic process to ornithine
cellular nitrogen compound metabolic process
cellular response to dexamethasone stimulus
cellular response to glucagon stimulus
cellular response to hydrogen peroxide
cellular response to interleukin-4
cellular response to lipopolysaccharide
cellular response to transforming growth factor beta stimulus
collagen biosynthetic process
liver development
lung development
mammary gland involution
maternal process involved in female pregnancy
polyamine metabolic process
positive regulation of endothelial cell proliferation
protein homotrimerization
regulation of L-arginine import
response to amine
response to amino acid
response to axon injury
response to cadmium ion
response to drug
response to herbicide
response to manganese ion
response to methylmercury
response to selenium ion
response to vitamin A
response to vitamin E
response to zinc ion
small molecule metabolic process
urea cycle - Gene Ontology Molecular Function:
- arginase activity
manganese ion binding - Gene Ontology Cellular Component:
- cytoplasm
cytosol
extracellular exosome
extracellular space
mitochondrial outer membrane
neuronal cell body
neuron projection
nucleus - Keywords:
- 3D-structure
Alternative splicing
Arginine metabolism
Complete proteome
Cytoplasm
Disease mutation
Hydrolase
Manganese
Metal-binding
Phosphoprotein
Polymorphism
Reference proteome
Urea cycle