Names & Taxonomy
- Uniprot ID:
- P02776
- Entry Name:
- PLF4_HUMAN
- Status:
- reviewed
- Protein Names:
- Platelet factor 4 (PF-4) (C-X-C motif chemokine 4) (Iroplact) (Oncostatin-A) [Cleaved into: Platelet factor 4, short form]
- Gene Names:
- PF4 CXCL4 SCYB4
- Gene Names Primary:
- PF4
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 101
- Sequence:
- MSSAAGFCASRPGLLFLGLLLLPLVVAFASAEAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Secreted.
Function
- Function:
- Released during platelet aggregation. Neutralizes the anticoagulant effect of heparin because it binds more strongly to heparin than to the chondroitin-4-sulfate chains of the carrier molecule. Chemotactic for neutrophils and monocytes. Inhibits endothelial cell proliferation, the short form is a more potent inhibitor than the longer form.
- Cross Reference Drug Bank:
- DB00055
- Gene Ontology Go:
- extracellular region
extracellular space
platelet alpha granule lumen
chemokine activity
CXCR3 chemokine receptor binding
heparin binding
blood coagulation
chemokine-mediated signaling pathway
cytokine-mediated signaling pathway
G-protein coupled receptor signaling pathway
immune response
inflammatory response
leukocyte chemotaxis
negative regulation of angiogenesis
negative regulation of cytolysis
negative regulation of extrinsic apoptotic signaling pathway in absence of ligand
negative regulation of megakaryocyte differentiation
negative regulation of MHC class II biosynthetic process
platelet activation
platelet degranulation
positive regulation of cAMP metabolic process
positive regulation of cAMP-mediated signaling
positive regulation of gene expression
positive regulation of leukocyte chemotaxis
positive regulation of macrophage derived foam cell differentiation
positive regulation of macrophage differentiation
positive regulation of transcription from RNA polymerase II promoter
positive regulation of tumor necrosis factor production
regulation of cell proliferation
response to lipopolysaccharide - Gene Ontology Biological Process:
- blood coagulation
chemokine-mediated signaling pathway
cytokine-mediated signaling pathway
G-protein coupled receptor signaling pathway
immune response
inflammatory response
leukocyte chemotaxis
negative regulation of angiogenesis
negative regulation of cytolysis
negative regulation of extrinsic apoptotic signaling pathway in absence of ligand
negative regulation of megakaryocyte differentiation
negative regulation of MHC class II biosynthetic process
platelet activation
platelet degranulation
positive regulation of cAMP-mediated signaling
positive regulation of cAMP metabolic process
positive regulation of gene expression
positive regulation of leukocyte chemotaxis
positive regulation of macrophage derived foam cell differentiation
positive regulation of macrophage differentiation
positive regulation of transcription from RNA polymerase II promoter
positive regulation of tumor necrosis factor production
regulation of cell proliferation
response to lipopolysaccharide - Gene Ontology Molecular Function:
- chemokine activity
CXCR3 chemokine receptor binding
heparin binding - Gene Ontology Cellular Component:
- extracellular region
extracellular space
platelet alpha granule lumen - Keywords:
- 3D-structure
Chemotaxis
Complete proteome
Cytokine
Direct protein sequencing
Disulfide bond
Heparin-binding
Phosphoprotein
Reference proteome
Secreted
Signal