Names & Taxonomy
- Uniprot ID:
- P02753
- Entry Name:
- RET4_HUMAN
- Status:
- reviewed
- Protein Names:
- Retinol-binding protein 4 (Plasma retinol-binding protein) (PRBP) (RBP) [Cleaved into: Plasma retinol-binding protein(1-182); Plasma retinol-binding protein(1-181); Plasma retinol-binding protein(1-179); Plasma retinol-binding protein(1-176)]
- Gene Names:
- RBP4 PRO2222
- Gene Names Orf:
- PRO2222
- Gene Names Primary:
- RBP4
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 201
- Sequence:
- MKWVWALLLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Secreted.
Function
- Function:
- Delivers retinol from the liver stores to the peripheral tissues. In plasma, the RBP-retinol complex interacts with transthyretin, this prevents its loss by filtration through the kidney glomeruli.
- Cross Reference Drug Bank:
- DB00162
- Gene Ontology Go:
- cytosol
extracellular exosome
extracellular region
extracellular space
protein complex
retinal binding
retinol binding
retinol transporter activity
cardiac muscle tissue development
embryonic organ morphogenesis
embryonic retina morphogenesis in camera-type eye
embryonic skeletal system development
eye development
fat-soluble vitamin metabolic process
female genitalia morphogenesis
gluconeogenesis
glucose homeostasis
heart development
heart trabecula formation
lung development
maintenance of gastrointestinal epithelium
negative regulation of cardiac muscle cell proliferation
phototransduction, visible light
positive regulation of immunoglobulin secretion
positive regulation of insulin secretion
response to ethanol
response to retinoic acid
retinoid metabolic process
retinol metabolic process
retinol transport
small molecule metabolic process
urinary bladder development
uterus development
vagina development
visual perception
vitamin metabolic process - Gene Ontology Biological Process:
- cardiac muscle tissue development
embryonic organ morphogenesis
embryonic retina morphogenesis in camera-type eye
embryonic skeletal system development
eye development
fat-soluble vitamin metabolic process
female genitalia morphogenesis
gluconeogenesis
glucose homeostasis
heart development
heart trabecula formation
lung development
maintenance of gastrointestinal epithelium
negative regulation of cardiac muscle cell proliferation
phototransduction, visible light
positive regulation of immunoglobulin secretion
positive regulation of insulin secretion
response to ethanol
response to retinoic acid
retinoid metabolic process
retinol metabolic process
retinol transport
small molecule metabolic process
urinary bladder development
uterus development
vagina development
visual perception
vitamin metabolic process - Gene Ontology Molecular Function:
- retinal binding
retinol binding
retinol transporter activity - Gene Ontology Cellular Component:
- cytosol
extracellular exosome
extracellular region
extracellular space
protein complex - Keywords:
- 3D-structure
Complete proteome
Direct protein sequencing
Disease mutation
Disulfide bond
Microphthalmia
Reference proteome
Retinol-binding
Secreted
Sensory transduction
Signal
Transport
Vision
Vitamin A - Interacts With:
- O55245