Names & Taxonomy
- Uniprot ID:
- P01892
- Entry Name:
- 1A02_HUMAN
- Status:
- reviewed
- Protein Names:
- HLA class I histocompatibility antigen, A-2 alpha chain (MHC class I antigen A*2)
- Gene Names:
- HLA-A HLAA
- Gene Names Primary:
- HLA-A
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 365
- Sequence:
- MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVITGAVVAAVMWRRKSSDRKGGSYSQAASSDSAQGSDVSLTACKV
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Membrane; Single-pass type I membrane protein.
Function
- Function:
- Involved in the presentation of foreign antigens to the immune system.
- Gene Ontology Go:
- cell surface
early endosome membrane
endoplasmic reticulum
endoplasmic reticulum exit site
ER to Golgi transport vesicle membrane
Golgi apparatus
Golgi medial cisterna
Golgi membrane
integral component of lumenal side of endoplasmic reticulum membrane
MHC class I protein complex
phagocytic vesicle membrane
plasma membrane
beta-2-microglobulin binding
peptide antigen binding
poly(A) RNA binding
receptor binding
T cell receptor binding
TAP binding
antibacterial humoral response
antigen processing and presentation of endogenous peptide antigen via MHC class I
antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway, TAP-independent
antigen processing and presentation of exogenous peptide antigen via MHC class I
antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent
antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-independent
antigen processing and presentation of peptide antigen via MHC class I
cytokine-mediated signaling pathway
defense response to Gram-positive bacterium
interferon-gamma-mediated signaling pathway
positive regulation of CD8-positive, alpha-beta T cell activation
positive regulation of CD8-positive, alpha-beta T cell proliferation
positive regulation of interferon-gamma production
positive regulation of memory T cell activation
positive regulation of T cell cytokine production
positive regulation of T cell mediated cytotoxicity
regulation of defense response to virus by virus
regulation of immune response
type I interferon signaling pathway
viral process - Gene Ontology Biological Process:
- antibacterial humoral response
antigen processing and presentation of endogenous peptide antigen via MHC class I
antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway, TAP-independent
antigen processing and presentation of exogenous peptide antigen via MHC class I
antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent
antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-independent
antigen processing and presentation of peptide antigen via MHC class I
cytokine-mediated signaling pathway
defense response to Gram-positive bacterium
interferon-gamma-mediated signaling pathway
positive regulation of CD8-positive, alpha-beta T cell activation
positive regulation of CD8-positive, alpha-beta T cell proliferation
positive regulation of interferon-gamma production
positive regulation of memory T cell activation
positive regulation of T cell cytokine production
positive regulation of T cell mediated cytotoxicity
regulation of defense response to virus by virus
regulation of immune response
type I interferon signaling pathway
viral process - Gene Ontology Molecular Function:
- beta-2-microglobulin binding
peptide antigen binding
poly(A) RNA binding
receptor binding
TAP binding
T cell receptor binding - Gene Ontology Cellular Component:
- cell surface
early endosome membrane
endoplasmic reticulum
endoplasmic reticulum exit site
ER to Golgi transport vesicle membrane
Golgi apparatus
Golgi medial cisterna
Golgi membrane
integral component of lumenal side of endoplasmic reticulum membrane
MHC class I protein complex
phagocytic vesicle membrane
plasma membrane - Keywords:
- 3D-structure
Complete proteome
Direct protein sequencing
Disulfide bond
Glycoprotein
Host-virus interaction
Immunity
MHC I
Membrane
Phosphoprotein
Polymorphism
Reference proteome
Signal
Transmembrane
Transmembrane helix
Ubl conjugation
Publication
- PubMed ID:
- 2982951 2914713 2320591 3863816 1317015 3874058 92029 6179086 7836067 3497874 3496393 1937577 1589035 2715640 3489037 2448239 2457548 3258580 2783680 1559719 8168863 7759139 7652742 9008310 10689125 10746792 10852390 18088087 19413330 19159218 24275569 3309677 11390610 12006494 12796775 2038058 21269460 25944712