Names & Taxonomy
- Uniprot ID:
- P01595
- Entry Name:
- KV103_HUMAN
- Status:
- reviewed
- Protein Names:
- Ig kappa chain V-I region Bi
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 108
- Sequence:
- DIQMTQSPSPLSASVGDSVTITCQASQDIRNSLIWYQQKPGKAPKFLIYDAENLEIGVPSRFRGSGSGTDFALSISSLQPEDFATYYCQQYYNLPYTFGQGTKLEIKR
- Proteomes:
- UP000005640
Function
- Gene Ontology Go:
- extracellular region
plasma membrane
antigen binding
complement activation
complement activation, classical pathway
Fc-epsilon receptor signaling pathway
Fc-gamma receptor signaling pathway involved in phagocytosis
immune response
innate immune response
receptor-mediated endocytosis
regulation of immune response - Gene Ontology Biological Process:
- complement activation
complement activation, classical pathway
Fc-epsilon receptor signaling pathway
Fc-gamma receptor signaling pathway involved in phagocytosis
immune response
innate immune response
receptor-mediated endocytosis
regulation of immune response - Gene Ontology Molecular Function:
- antigen binding
- Gene Ontology Cellular Component:
- extracellular region
plasma membrane - Keywords:
- Bence-Jones protein
Complete proteome
Direct protein sequencing
Disulfide bond
Immunoglobulin V region
Immunoglobulin domain
Reference proteome
Publication
- PubMed ID:
- 4563064