Names & Taxonomy
- Uniprot ID:
- P01178
- Entry Name:
- NEU1_HUMAN
- Status:
- reviewed
- Protein Names:
- Oxytocin-neurophysin 1 (OT-NPI) [Cleaved into: Oxytocin (Ocytocin); Neurophysin 1]
- Gene Names:
- OXT OT
- Gene Names Primary:
- OXT
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 125
- Sequence:
- MAGPSLACCLLGLLALTSACYIQNCPLGGKRAAPDLDVRKCLPCGPGGKGRCFGPNICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAVLGLCCSPDGCHADPACDAEATFSQR
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Secreted.
Function
- Function:
- Neurophysin 1 specifically binds oxytocin.; Oxytocin causes contraction of the smooth muscle of the uterus and of the mammary gland.
- Cross Reference Drug Bank:
- DB00107
- Gene Ontology Go:
- cytosol
extracellular region
extracellular space
secretory granule
terminal bouton
drinking behavior
eating behavior
female pregnancy
grooming behavior
heart development
hyperosmotic salinity response
male mating behavior
maternal aggressive behavior
maternal behavior
memory
negative regulation of blood pressure
negative regulation of gastric acid secretion
negative regulation of urine volume
positive regulation of blood pressure
positive regulation of cytosolic calcium ion concentration
positive regulation of female receptivity
positive regulation of hindgut contraction
positive regulation of norepinephrine secretion
positive regulation of ossification
positive regulation of penile erection
positive regulation of prostaglandin secretion
positive regulation of renal sodium excretion
positive regulation of synapse assembly
positive regulation of synaptic transmission
positive regulation of uterine smooth muscle contraction
regulation of heart rate
regulation of sensory perception of pain
response to activity
response to amphetamine
response to cAMP
response to cocaine
response to electrical stimulus
response to estradiol
response to ether
response to food
response to glucocorticoid
response to peptide hormone
response to progesterone
response to prostaglandin E
response to retinoic acid
response to sucrose
signal transduction
sleep
social behavior
sperm ejaculation - Gene Ontology Biological Process:
- drinking behavior
eating behavior
female pregnancy
grooming behavior
heart development
hyperosmotic salinity response
male mating behavior
maternal aggressive behavior
maternal behavior
memory
negative regulation of blood pressure
negative regulation of gastric acid secretion
negative regulation of urine volume
positive regulation of blood pressure
positive regulation of cytosolic calcium ion concentration
positive regulation of female receptivity
positive regulation of hindgut contraction
positive regulation of norepinephrine secretion
positive regulation of ossification
positive regulation of penile erection
positive regulation of prostaglandin secretion
positive regulation of renal sodium excretion
positive regulation of synapse assembly
positive regulation of synaptic transmission
positive regulation of uterine smooth muscle contraction
regulation of heart rate
regulation of sensory perception of pain
response to activity
response to amphetamine
response to cAMP
response to cocaine
response to electrical stimulus
response to estradiol
response to ether
response to food
response to glucocorticoid
response to peptide hormone
response to progesterone
response to prostaglandin E
response to retinoic acid
response to sucrose
signal transduction
sleep
social behavior
sperm ejaculation - Gene Ontology Cellular Component:
- cytosol
extracellular region
extracellular space
secretory granule
terminal bouton - Keywords:
- Amidation
Cleavage on pair of basic residues
Complete proteome
Direct protein sequencing
Disulfide bond
Hormone
Pharmaceutical
Reference proteome
Secreted
Signal - Interacts With:
- P16333