Names & Taxonomy
- Uniprot ID:
- P01116
- Entry Name:
- RASK_HUMAN
- Status:
- reviewed
- Protein Names:
- GTPase KRas (K-Ras 2) (Ki-Ras) (c-K-ras) (c-Ki-ras) [Cleaved into: GTPase KRas, N-terminally processed]
- Gene Names:
- KRAS KRAS2 RASK2
- Gene Names Primary:
- KRAS
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 189
- Sequence:
- MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKKCIIM
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Cell membrane
Function
- Function:
- Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. Plays an important role in the regulation of cell proliferation (PubMed:23698361, PubMed:22711838). Plays a role in promoting oncogenic events by inducing transcriptional silencing of tumor suppressor genes (TSGs) in colorectal cancer (CRC) cells in a ZNF304-dependent manner (PubMed:24623306).
- Enzyme Regulation:
- ENZYME REGULATION: Alternates between an inactive form bound to GDP and an active form bound to GTP. Activated by a guanine nucleotide-exchange factor (GEF) and inactivated by a GTPase-activating protein (GAP). Interaction with SOS1 promotes exchange of bound GDP by GTP.
- Gene Ontology Go:
- cytoplasm
cytosol
extrinsic component of cytoplasmic side of plasma membrane
focal adhesion
membrane
membrane raft
mitochondrion
plasma membrane
GDP binding
GMP binding
GTP binding
GTPase activity
protein complex binding
actin cytoskeleton organization
activation of MAPKK activity
axon guidance
blood coagulation
cytokine-mediated signaling pathway
endocrine signaling
epidermal growth factor receptor signaling pathway
epithelial tube branching involved in lung morphogenesis
Fc-epsilon receptor signaling pathway
fibroblast growth factor receptor signaling pathway
forebrain astrocyte development
homeostasis of number of cells within a tissue
innate immune response
insulin receptor signaling pathway
leukocyte migration
MAPK cascade
negative regulation of cell differentiation
negative regulation of neuron apoptotic process
neurotrophin TRK receptor signaling pathway
positive regulation of cell proliferation
positive regulation of gene expression
positive regulation of MAP kinase activity
positive regulation of NF-kappaB transcription factor activity
positive regulation of nitric-oxide synthase activity
positive regulation of protein phosphorylation
positive regulation of Rac protein signal transduction
Ras protein signal transduction
regulation of long-term neuronal synaptic plasticity
regulation of protein stability
regulation of synaptic transmission, GABAergic
response to glucocorticoid
response to mineralocorticoid
small GTPase mediated signal transduction
social behavior
stimulatory C-type lectin receptor signaling pathway
striated muscle cell differentiation
vascular endothelial growth factor receptor signaling pathway
visual learning - Gene Ontology Biological Process:
- actin cytoskeleton organization
activation of MAPKK activity
axon guidance
blood coagulation
cytokine-mediated signaling pathway
endocrine signaling
epidermal growth factor receptor signaling pathway
epithelial tube branching involved in lung morphogenesis
Fc-epsilon receptor signaling pathway
fibroblast growth factor receptor signaling pathway
forebrain astrocyte development
homeostasis of number of cells within a tissue
innate immune response
insulin receptor signaling pathway
leukocyte migration
MAPK cascade
negative regulation of cell differentiation
negative regulation of neuron apoptotic process
neurotrophin TRK receptor signaling pathway
positive regulation of cell proliferation
positive regulation of gene expression
positive regulation of MAP kinase activity
positive regulation of NF-kappaB transcription factor activity
positive regulation of nitric-oxide synthase activity
positive regulation of protein phosphorylation
positive regulation of Rac protein signal transduction
Ras protein signal transduction
regulation of long-term neuronal synaptic plasticity
regulation of protein stability
regulation of synaptic transmission, GABAergic
response to glucocorticoid
response to mineralocorticoid
small GTPase mediated signal transduction
social behavior
stimulatory C-type lectin receptor signaling pathway
striated muscle cell differentiation
vascular endothelial growth factor receptor signaling pathway
visual learning - Gene Ontology Molecular Function:
- GDP binding
GMP binding
GTPase activity
GTP binding
protein complex binding - Gene Ontology Cellular Component:
- cytoplasm
cytosol
extrinsic component of cytoplasmic side of plasma membrane
focal adhesion
membrane
membrane raft
mitochondrion
plasma membrane - Keywords:
- 3D-structure
Acetylation
Alternative splicing
Cardiomyopathy
Cell membrane
Complete proteome
Cytoplasm
Deafness
Direct protein sequencing
Disease mutation
Ectodermal dysplasia
GTP-binding
Lipoprotein
Membrane
Mental retardation
Methylation
Nucleotide-binding
Palmitate
Polymorphism
Prenylation
Proto-oncogene
Reference proteome
S-nitrosylation - Interacts With:
- Q96II5; Q04631; P04049; P50749
Publication
- PubMed ID:
- 6308466 6308465 6308467 6092920 3310850 14702039 15489334 6320174 3855240 3034404 6695174 3932274 6096811 21269460 22711838 23698361 24623306 25944712 22566140 22431598 3627975 1553789 8439212 7773929 8955068 14534542 16247081 16773572 16533793 16474404 16474405 16959974 17332249 17468812 17056636 19396835 20949621 21797849