Names & Taxonomy
- Uniprot ID:
- O95881
- Entry Name:
- TXD12_HUMAN
- Status:
- reviewed
- Protein Names:
- Thioredoxin domain-containing protein 12 (EC 1.8.4.2) (Endoplasmic reticulum resident protein 18) (ER protein 18) (ERp18) (Endoplasmic reticulum resident protein 19) (ER protein 19) (ERp19) (Thioredoxin-like protein p19) (hTLP19)
- Gene Names:
- TXNDC12 TLP19 UNQ713/PRO1376
- Gene Names Orf:
- UNQ713/PRO1376
- Gene Names Primary:
- TXNDC12
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 172
- Sequence:
- METRPRLGATCLLGFSFLLLVISSDGHNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPKDEDFSPDGGYIPRILFLDPSGKVHPEIINENGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFRKKHLEDEL
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Endoplasmic reticulum lumen
Function
- Function:
- Possesses significant protein thiol-disulfide oxidase activity.
- Catalytic Activity:
- 2 glutathione + protein-disulfide = glutathione disulfide + protein-dithiol.
- Kinetics:
- BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=25 uM for Asn-Arg-Cys-Ser-Gln-Gly-Ser-Cys-Trp-Asn;
- Cross Reference Drug Bank:
- DB00143
- Gene Ontology Go:
- endoplasmic reticulum lumen
peptide disulfide oxidoreductase activity
protein-disulfide reductase (glutathione) activity
cell redox homeostasis
negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway - Gene Ontology Biological Process:
- cell redox homeostasis
negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway - Gene Ontology Molecular Function:
- peptide disulfide oxidoreductase activity
protein-disulfide reductase (glutathione) activity - Gene Ontology Cellular Component:
- endoplasmic reticulum lumen
- Keywords:
- 3D-structure
Complete proteome
Direct protein sequencing
Disulfide bond
Endoplasmic reticulum
Oxidoreductase
Redox-active center
Reference proteome
Signal - Interacts With:
- O95198; O43765; Q96EQ0; Q9UMX0; Q9UMX0-2