Names & Taxonomy
- Uniprot ID:
- O60939
- Entry Name:
- SCN2B_HUMAN
- Status:
- reviewed
- Protein Names:
- Sodium channel subunit beta-2
- Gene Names:
- SCN2B UNQ326/PRO386
- Gene Names Orf:
- UNQ326/PRO386
- Gene Names Primary:
- SCN2B
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 215
- Sequence:
- MHRDAWLPRPAFSLTGLSLFFSLVPPGRSMEVTVPATLNVLNGSDARLPCTFNSCYTVNHKQFSLNWTYQECNNCSEEMFLQFRMKIINLKLERFQDRVEFSGNPSKYDVSVMLRNVQPEDEGIYNCYIMNPPDRHRGHGKIHLQVLMEEPPERDSTVAVIVGASVGGFLAVVILVLMVVKCVRRKKEQKLSTDDLKTEEEGKTDGEGNPDDGAK
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Membrane; Single-pass type I membrane protein.
Function
- Function:
- Crucial in the assembly, expression, and functional modulation of the heterotrimeric complex of the sodium channel. The subunit beta-2 causes an increase in the plasma membrane surface area and in its folding into microvilli. Interacts with TNR may play a crucial role in clustering and regulation of activity of sodium channels at nodes of Ranvier (By similarity).
- Cross Reference Drug Bank:
- DB00313 DB00909
- Gene Ontology Go:
- voltage-gated sodium channel complex
sodium channel regulator activity
voltage-gated sodium channel activity involved in cardiac muscle cell action potential
cardiac muscle cell action potential involved in contraction
cardiac muscle contraction
membrane depolarization during cardiac muscle cell action potential
nervous system development
regulation of atrial cardiac muscle cell membrane depolarization
regulation of heart rate by cardiac conduction
regulation of sodium ion transmembrane transporter activity
response to pyrethroid
sodium ion transmembrane transport
synaptic transmission - Gene Ontology Biological Process:
- cardiac muscle cell action potential involved in contraction
cardiac muscle contraction
membrane depolarization during cardiac muscle cell action potential
nervous system development
regulation of atrial cardiac muscle cell membrane depolarization
regulation of heart rate by cardiac conduction
regulation of sodium ion transmembrane transporter activity
response to pyrethroid
sodium ion transmembrane transport
synaptic transmission - Gene Ontology Molecular Function:
- sodium channel regulator activity
voltage-gated sodium channel activity involved in cardiac muscle cell action potential - Gene Ontology Cellular Component:
- voltage-gated sodium channel complex
- Keywords:
- 3D-structure
Atrial fibrillation
Brugada syndrome
Complete proteome
Disease mutation
Disulfide bond
Glycoprotein
Immunoglobulin domain
Ion channel
Ion transport
Membrane
Phosphoprotein
Polymorphism
Reference proteome
Signal
Sodium
Sodium channel
Sodium transport
Transmembrane
Transmembrane helix
Transport
Voltage-gated channel