Names & Taxonomy
- Uniprot ID:
- O15244
- Entry Name:
- S22A2_HUMAN
- Status:
- reviewed
- Protein Names:
- Solute carrier family 22 member 2 (Organic cation transporter 2) (hOCT2)
- Gene Names:
- SLC22A2 OCT2
- Gene Names Primary:
- SLC22A2
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 555
- Sequence:
- MPTTVDDVLEHGGEFHFFQKQMFFLLALLSATFAPIYVGIVFLGFTPDHRCRSPGVAELSLRCGWSPAEELNYTVPGPGPAGEASPRQCRRYEVDWNQSTFDCVDPLASLDTNRSRLPLGPCRDGWVYETPGSSIVTEFNLVCANSWMLDLFQSSVNVGFFIGSMSIGYIADRFGRKLCLLTTVLINAAAGVLMAISPTYTWMLIFRLIQGLVSKAGWLIGYILITEFVGRRYRRTVGIFYQVAYTVGLLVLAGVAYALPHWRWLQFTVSLPNFFFLLYYWCIPESPRWLISQNKNAEAMRIIKHIAKKNGKSLPASLQRLRLEEETGKKLNPSFLDLVRTPQIRKHTMILMYNWFTSSVLYQGLIMHMGLAGDNIYLDFFYSALVEFPAAFMIILTIDRIGRRYPWAASNMVAGAACLASVFIPGDLQWLKIIISCLGRMGITMAYEIVCLVNAELYPTFIRNLGVHICSSMCDIGGIITPFLVYRLTNIWLELPLMVFGVLGLVAGGLVLLLPETKGKALPETIEEAENMQRPRKNKEKMIYLQVQKLDIPLN
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Membrane
Function
- Function:
- Mediates tubular uptake of organic compounds from circulation. Mediates the influx of agmatine, dopamine, noradrenaline (norepinephrine), serotonin, choline, famotidine, ranitidine, histamin, creatinine, amantadine, memantine, acriflavine, 4--N-methylpyridinium ASP, amiloride, metformin, N-1-methylnicotinamide (NMN), tetraethylammonium (TEA), 1-methyl-4-phenylpyridinium (MPP), cimetidine, cisplatin and oxaliplatin. Cisplatin may develop a nephrotoxic action. Transport of creatinine is inhibited by fluoroquinolones such as DX-619 and LVFX. This transporter is a major determinant of the anticancer activity of oxaliplatin and may contribute to antitumor specificity.
- Kinetics:
- BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=1 mM for agmatine
- Cross Reference Drug Bank:
- DB00915 DB00594 DB00345 DB01114 DB00122 DB00501 DB00515 DB00242 DB00907 DB00987 DB00694 DB01151 DB01160 DB00917 DB01075 DB00280 DB00988 DB00668 DB00783 DB00927 DB00690 DB00536 DB00667 DB00619 DB00458 DB00709 DB01137 DB01043 DB00331 DB00264 DB00184 DB00368 DB00526 DB01580 DB01337 DB00914 DB00925 DB00413 DB00457 DB01032 DB01035 DB00396 DB00571 DB01103 DB00908 DB00468 DB00206 DB00152 DB01199 DB00570 DB00495
- Gene Ontology Go:
- basolateral plasma membrane
extracellular exosome
integral component of plasma membrane
membrane
plasma membrane
presynapse
choline transmembrane transporter activity
dopamine transmembrane transporter activity
organic cation transmembrane transporter activity
quaternary ammonium group transmembrane transporter activity
steroid binding
ammonium transmembrane transport
body fluid secretion
choline transport
dopamine transport
drug transmembrane transport
histamine transport
neurotransmitter biosynthetic process
neurotransmitter secretion
organic cation transport
small molecule metabolic process
synaptic transmission
transmembrane transport - Gene Ontology Biological Process:
- ammonium transmembrane transport
body fluid secretion
choline transport
dopamine transport
drug transmembrane transport
histamine transport
neurotransmitter biosynthetic process
neurotransmitter secretion
organic cation transport
small molecule metabolic process
synaptic transmission
transmembrane transport - Gene Ontology Molecular Function:
- choline transmembrane transporter activity
dopamine transmembrane transporter activity
organic cation transmembrane transporter activity
quaternary ammonium group transmembrane transporter activity
steroid binding - Gene Ontology Cellular Component:
- basolateral plasma membrane
extracellular exosome
integral component of plasma membrane
membrane
plasma membrane
presynapse - Keywords:
- Alternative splicing
Complete proteome
Glycoprotein
Ion transport
Membrane
Polymorphism
Reference proteome
Transmembrane
Transmembrane helix
Transport