Names & Taxonomy
- Uniprot ID:
- Q9Y478
- Entry Name:
- AAKB1_HUMAN
- Status:
- reviewed
- Protein Names:
- 5'-AMP-activated protein kinase subunit beta-1 (AMPK subunit beta-1) (AMPKb)
- Gene Names:
- PRKAB1 AMPK
- Gene Names Primary:
- PRKAB1
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 270
- Sequence:
- MGNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVNDKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSHNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELSSSPPGPYHQEPYVCKPEERFRAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI
- Proteomes:
- UP000005640
Function
- Function:
- Non-catalytic subunit of AMP-activated protein kinase (AMPK), an energy sensor protein kinase that plays a key role in regulating cellular energy metabolism. In response to reduction of intracellular ATP levels, AMPK activates energy-producing pathways and inhibits energy-consuming processes: inhibits protein, carbohydrate and lipid biosynthesis, as well as cell growth and proliferation. AMPK acts via direct phosphorylation of metabolic enzymes, and by longer-term effects via phosphorylation of transcription regulators. Also acts as a regulator of cellular polarity by remodeling the actin cytoskeleton; probably by indirectly activating myosin. Beta non-catalytic subunit acts as a scaffold on which the AMPK complex assembles, via its C-terminus that bridges alpha (PRKAA1 or PRKAA2) and gamma subunits (PRKAG1, PRKAG2 or PRKAG3).
- Cross Reference Drug Bank:
- DB00945 DB00131 DB00331
- Gene Ontology Go:
- cytosol
nucleotide-activated protein kinase complex
nucleus
AMP-activated protein kinase activity
protein kinase activity
cell cycle arrest
fatty acid biosynthetic process
gene expression
insulin receptor signaling pathway
macroautophagy
membrane organization
mitochondrion organization
organelle organization
positive regulation of gene expression
protein heterooligomerization
protein phosphorylation
regulation of protein kinase activity
signal transduction
transcription initiation from RNA polymerase II promoter - Gene Ontology Biological Process:
- cell cycle arrest
fatty acid biosynthetic process
gene expression
insulin receptor signaling pathway
macroautophagy
membrane organization
mitochondrion organization
organelle organization
positive regulation of gene expression
protein heterooligomerization
protein phosphorylation
regulation of protein kinase activity
signal transduction
transcription initiation from RNA polymerase II promoter - Gene Ontology Molecular Function:
- AMP-activated protein kinase activity
protein kinase activity - Gene Ontology Cellular Component:
- cytosol
nucleotide-activated protein kinase complex
nucleus - Keywords:
- 3D-structure
Complete proteome
Fatty acid biosynthesis
Fatty acid metabolism
Lipid biosynthesis
Lipid metabolism
Lipoprotein
Myristate
Phosphoprotein
Reference proteome - Interacts With:
- O70302; P62993; Q13131; P54619