Names & Taxonomy
- Uniprot ID:
- Q9UPY5
- Entry Name:
- XCT_HUMAN
- Status:
- reviewed
- Protein Names:
- Cystine/glutamate transporter (Amino acid transport system xc-) (Calcium channel blocker resistance protein CCBR1) (Solute carrier family 7 member 11) (xCT)
- Gene Names:
- SLC7A11
- Gene Names Primary:
- SLC7A11
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 501
- Sequence:
- MVRKPVVSTISKGGYLQGNVNGRLPSLGNKEPPGQEKVQLKRKVTLLRGVSIIIGTIIGAGIFISPKGVLQNTGSVGMSLTIWTVCGVLSLFGALSYAELGTTIKKSGGHYTYILEVFGPLPAFVRVWVELLIIRPAATAVISLAFGRYILEPFFIQCEIPELAIKLITAVGITVVMVLNSMSVSWSARIQIFLTFCKLTAILIIIVPGVMQLIKGQTQNFKDAFSGRDSSITRLPLAFYYGMYAYAGWFYLNFVTEEVENPEKTIPLAICISMAIVTIGYVLTNVAYFTTINAEELLLSNAVAVTFSERLLGNFSLAVPIFVALSCFGSMNGGVFAVSRLFYVASREGHLPEILSMIHVRKHTPLPAVIVLHPLTMIMLFSGDLDSLLNFLSFARWLFIGLAVAGLIYLRYKCPDMHRPFKVPLFIPALFSFTCLFMVALSLYSDPFSTGIGFVITLTGVPAYYLFIIWDKKPRWFRIMSEKITRTLQIILEVVPEEDKL
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Membrane
Function
- Function:
- Sodium-independent, high-affinity exchange of anionic amino acids with high specificity for anionic form of cystine and glutamate.
- Cross Reference Drug Bank:
- DB06151 DB00138 DB00740 DB01098 DB00795 DB08834
- Gene Ontology Go:
- cell surface
cytoskeleton
integral component of membrane
plasma membrane
rough endoplasmic reticulum
cystine:glutamate antiporter activity
amino acid transport
blood coagulation
brain development
ion transport
L-glutamate transmembrane transport
lens fiber cell differentiation
leukocyte migration
platelet aggregation
response to nicotine
response to oxidative stress
response to toxic substance
transmembrane transport - Gene Ontology Biological Process:
- amino acid transport
blood coagulation
brain development
ion transport
lens fiber cell differentiation
leukocyte migration
L-glutamate transmembrane transport
platelet aggregation
response to nicotine
response to oxidative stress
response to toxic substance
transmembrane transport - Gene Ontology Molecular Function:
- cystine:glutamate antiporter activity
- Gene Ontology Cellular Component:
- cell surface
cytoskeleton
integral component of membrane
plasma membrane
rough endoplasmic reticulum - Keywords:
- Amino-acid transport
Complete proteome
Disulfide bond
Glycoprotein
Membrane
Phosphoprotein
Reference proteome
Transmembrane
Transmembrane helix
Transport - Interacts With:
- P16070