Names & Taxonomy
- Uniprot ID:
- Q9UM01
- Entry Name:
- YLAT1_HUMAN
- Status:
- reviewed
- Protein Names:
- Y+L amino acid transporter 1 (Monocyte amino acid permease 2) (MOP-2) (Solute carrier family 7 member 7) (y(+)L-type amino acid transporter 1) (Y+LAT1) (y+LAT-1)
- Gene Names:
- SLC7A7
- Gene Names Primary:
- SLC7A7
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 511
- Sequence:
- MVDSTEYEVASQPEVETSPLGDGASPGPEQVKLKKEISLLNGVCLIVGNMIGSGIFVSPKGVLIYSASFGLSLVIWAVGGLFSVFGALCYAELGTTIKKSGASYAYILEAFGGFLAFIRLWTSLLIIEPTSQAIIAITFANYMVQPLFPSCFAPYAASRLLAAACICLLTFINCAYVKWGTLVQDIFTYAKVLALIAVIVAGIVRLGQGASTHFENSFEGSSFAVGDIALALYSALFSYSGWDTLNYVTEEIKNPERNLPLSIGISMPIVTIIYILTNVAYYTVLDMRDILASDAVAVTFADQIFGIFNWIIPLSVALSCFGGLNASIVAASRLFFVGSREGHLPDAICMIHVERFTPVPSLLFNGIMALIYLCVEDIFQLINYYSFSYWFFVGLSIVGQLYLRWKEPDRPRPLKLSVFFPIVFCLCTIFLVAVPLYSDTINSLIGIAIALSGLPFYFLIIRVPEHKRPLYLRRIVGSATRYLQVLCMSVAAEMDLEDGGEMPKQRDPKSN
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Basolateral cell membrane
Function
- Function:
- Involved in the sodium-independent uptake of dibasic amino acids and sodium-dependent uptake of some neutral amino acids. Requires coexpression with SLC3A2/4F2hc to mediate the uptake of arginine, leucine and glutamine. Plays a role in nitric oxide synthesis in human umbilical vein endothelial cells (HUVECs) via transport of L-arginine. Involved in the transport of L-arginine in monocytes.
- Kinetics:
- BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=31.7 uM for L-leucine (in the presence of 0.1 M NaCl)
- Enzyme Regulation:
- ENZYME REGULATION: Arginine transport is inhibited by protein kinase C (PKC) and treatment with phorbol-12-myristate-13-acetate (PMA).
- Gene Ontology Go:
- basolateral plasma membrane
integral component of plasma membrane
plasma membrane
antiporter activity
basic amino acid transmembrane transporter activity
L-amino acid transmembrane transporter activity
amino acid transport
blood coagulation
cellular amino acid metabolic process
ion transport
L-alpha-amino acid transmembrane transport
L-amino acid transport
leukocyte migration
protein complex assembly
regulation of arginine metabolic process
transmembrane transport
transport - Gene Ontology Biological Process:
- amino acid transport
blood coagulation
cellular amino acid metabolic process
ion transport
L-alpha-amino acid transmembrane transport
L-amino acid transport
leukocyte migration
protein complex assembly
regulation of arginine metabolic process
transmembrane transport
transport - Gene Ontology Molecular Function:
- antiporter activity
basic amino acid transmembrane transporter activity
L-amino acid transmembrane transporter activity - Gene Ontology Cellular Component:
- basolateral plasma membrane
integral component of plasma membrane
plasma membrane - Keywords:
- Amino-acid transport
Cell membrane
Complete proteome
Disease mutation
Disulfide bond
Glycoprotein
Membrane
Phosphoprotein
Polymorphism
Reference proteome
Transmembrane
Transmembrane helix
Transport