Names & Taxonomy
- Uniprot ID:
- Q8WW43
- Entry Name:
- APH1B_HUMAN
- Status:
- reviewed
- Protein Names:
- Gamma-secretase subunit APH-1B (APH-1b) (Aph-1beta) (Presenilin-stabilization factor-like)
- Gene Names:
- APH1B PSFL UNQ688/PRO1328
- Gene Names Orf:
- UNQ688/PRO1328
- Gene Names Primary:
- APH1B
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 257
- Sequence:
- MTAAVFFGCAFIAFGPALALYVFTIATEPLRIIFLIAGAFFWLVSLLISSLVWFMARVIIDNKDGPTQKYLLIFGAFVSVYIQEMFRFAYYKLLKKASEGLKSINPGETAPSMRLLAYVSGLGFGIMSGVFSFVNTLSDSLGPGTVGIHGDSPQFFLYSAFMTLVIILLHVFWGIVFFDGCEKKKWGILLIVLLTHLLVSAQTFISSYYGINLASAFIILVLMGTWAFLAAGGSCRSLKLCLLCQDKNFLLYNQRSR
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Membrane
Function
- Function:
- Probable subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral proteins such as Notch receptors and APP (beta-amyloid precursor protein). It probably represents a stabilizing cofactor for the presenilin homodimer that promotes the formation of a stable complex. Probably present in a minority of gamma-secretase complexes compared to APH1A.
- Gene Ontology Go:
- integral component of membrane
plasma membrane
transport vesicle
peptidase activity
apoptotic signaling pathway
axon guidance
ephrin receptor signaling pathway
membrane protein intracellular domain proteolysis
neurotrophin TRK receptor signaling pathway
Notch receptor processing
Notch signaling pathway
positive regulation of apoptotic process
positive regulation of catalytic activity
protein processing - Gene Ontology Biological Process:
- apoptotic signaling pathway
axon guidance
ephrin receptor signaling pathway
membrane protein intracellular domain proteolysis
neurotrophin TRK receptor signaling pathway
Notch receptor processing
Notch signaling pathway
positive regulation of apoptotic process
positive regulation of catalytic activity
protein processing - Gene Ontology Molecular Function:
- peptidase activity
- Gene Ontology Cellular Component:
- integral component of membrane
plasma membrane
transport vesicle - Keywords:
- Alternative splicing
Complete proteome
Membrane
Notch signaling pathway
Polymorphism
Reference proteome
Transmembrane
Transmembrane helix