Names & Taxonomy
- Uniprot ID:
- Q7LBE3
- Entry Name:
- S26A9_HUMAN
- Status:
- reviewed
- Protein Names:
- Solute carrier family 26 member 9 (Anion transporter/exchanger protein 9)
- Gene Names:
- SLC26A9
- Gene Names Primary:
- SLC26A9
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 791
- Sequence:
- MSQPRPRYVVDRAAYSLTLFDDEFEKKDRTYPVGEKLRNAFRCSSAKIKAVVFGLLPVLSWLPKYKIKDYIIPDLLGGLSGGSIQVPQGMAFALLANLPAVNGLYSSFFPLLTYFFLGGVHQMVPGTFAVISILVGNICLQLAPESKFQVFNNATNESYVDTAAMEAERLHVSATLACLTAIIQMGLGFMQFGFVAIYLSESFIRGFMTAAGLQILISVLKYIFGLTIPSYTGPGSIVFTFIDICKNLPHTNIASLIFALISGAFLVLVKELNARYMHKIRFPIPTEMIVVVVATAISGGCKMPKKYHMQIVGEIQRGFPTPVSPVVSQWKDMIGTAFSLAIVSYVINLAMGRTLANKHGYDVDSNQEMIALGCSNFFGSFFKIHVICCALSVTLAVDGAGGKSQVASLCVSLVVMITMLVLGIYLYPLPKSVLGALIAVNLKNSLKQLTDPYYLWRKSKLDCCIWVVSFLSSFFLSLPYGVAVGVAFSVLVVVFQTQFRNGYALAQVMDTDIYVNPKTYNRAQDIQGIKIITYCSPLYFANSEIFRQKVIAKTGMDPQKVLLAKQKYLKKQEKRRMRPTQQRRSLFMKTKTVSLQELQQDFENAPPTDPNNNQTPANGTSVSYITFSPDSSSPAQSEPPASAEAPGEPSDMLASVPPFVTFHTLILDMSGVSFVDLMGIKALAKLSSTYGKIGVKVFLVNIHAQVYNDISHGGVFEDGSLECKHVFPSIHDAVLFAQANARDVTPGHNFQGAPGDAELSLYDSEEDIRSYWDLEQEMFGSMFHAETLTAL
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Membrane
Function
- Function:
- DIDS- and thiosulfate- sensitive anion exchanger mediating chloride, sulfate and oxalate transport. Mediates chloride/bicarbonate exchange or chloride-independent bicarbonate extrusion thus assuring bicarbonate secretion. Inhibited by ammonium and thiosulfate.
- Gene Ontology Go:
- apical plasma membrane
cell surface
extracellular exosome
integral component of plasma membrane
plasma membrane
anion:anion antiporter activity
ATPase binding
bicarbonate transmembrane transporter activity
chloride channel activity
oxalate transmembrane transporter activity
secondary active sulfate transmembrane transporter activity
sulfate transmembrane transporter activity
anion transmembrane transport
anion transport
bicarbonate transport
chloride transmembrane transport
chloride transport
ion transport
oxalate transport
positive regulation of gene expression
regulation of intracellular pH
regulation of membrane potential
sulfate transmembrane transport
transmembrane transport - Gene Ontology Biological Process:
- anion transmembrane transport
anion transport
bicarbonate transport
chloride transmembrane transport
chloride transport
ion transport
oxalate transport
positive regulation of gene expression
regulation of intracellular pH
regulation of membrane potential
sulfate transmembrane transport
transmembrane transport - Gene Ontology Molecular Function:
- anion:anion antiporter activity
ATPase binding
bicarbonate transmembrane transporter activity
chloride channel activity
oxalate transmembrane transporter activity
secondary active sulfate transmembrane transporter activity
sulfate transmembrane transporter activity - Gene Ontology Cellular Component:
- apical plasma membrane
cell surface
extracellular exosome
integral component of plasma membrane
plasma membrane - Keywords:
- Alternative splicing
Complete proteome
Membrane
Polymorphism
Reference proteome
Transmembrane
Transmembrane helix