Names & Taxonomy
- Uniprot ID:
- Q2VIR3
- Entry Name:
- IF2GL_HUMAN
- Status:
- reviewed
- Protein Names:
- Putative eukaryotic translation initiation factor 2 subunit 3-like protein (Eukaryotic translation initiation factor 2 subunit gamma A) (eIF-2-gamma A) (eIF-2gA)
- Gene Names:
- EIF2S3L
- Gene Names Primary:
- EIF2S3L
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 472
- Sequence:
- MAGGEAGVTLGQPHLSRQDLTTLDVTKLTPLSHEVISRQATINIGTIGHVAHGKSTVVKAISGVHTVRFKNELERNITIKLGYANAKIYQLDDPSCPRPECYRSCGSSMPDEFPTDIPGTKGNFRLVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNESCPQPQTSEHLAAIEIMKLKHILILQNKIDLVKERQAKEQYEQILAFVQGTVAEGAPIIPISAQLKYNIEVVCEYIVKKIPVPPRDFTSEPRLIVIRSFDVNKPGCEVDDLKGGVAGGSILKGVLKVGQETEVRPGIVSKDSEGKLMCKSIFSKIVSLFAEHNDLQYAAPGGLIGVGTKIDPTLCRADRMVGQILGAVGALPEIFTELEISYFLLRRLLGVRTEGDKKAAKVQKLSKNEVLMVNIGSLSTGGRVSAVKADLGKIVLTNPVCTEVGEKIALSRRVEKHWRLIGWGQIRRGVTIKPTVDDD
- Proteomes:
- UP000005640
Function
- Function:
- As a subunit of eukaryotic initiation factor 2 (eIF2), involved in the early steps of protein synthesis. In the presence of GTP, eIF2 forms a ternary complex with initiator tRNA Met-tRNAi and then recruits the 40S ribosomal complex, a step that determines the rate of protein translation. This step is followed by mRNA binding to form the 43S pre-initiation complex. Junction of the 60S ribosomal subunit to form the 80S initiation complex is preceded by hydrolysis of the GTP bound to eIF2 and release of an eIF2-GDP binary complex. In order for eIF2 to recycle and catalyze another round of initiation, the GDP bound to eIF2 must exchange with GTP by way of a reaction catalyzed by eIF2B (By similarity). Along with its paralog on chromosome Y, may contribute to spermatogenesis up to the round spermatid stage (By similarity).
- Gene Ontology Go:
- intracellular
GTP binding
GTPase activity
translation initiation factor activity
formation of translation preinitiation complex - Gene Ontology Biological Process:
- formation of translation preinitiation complex
- Gene Ontology Molecular Function:
- GTPase activity
GTP binding
translation initiation factor activity - Gene Ontology Cellular Component:
- intracellular
- Keywords:
- Acetylation
Alternative splicing
Complete proteome
GTP-binding
Initiation factor
Nucleotide-binding
Phosphoprotein
Protein biosynthesis
Reference proteome