Names & Taxonomy
- Uniprot ID:
- Q16878
- Entry Name:
- CDO1_HUMAN
- Status:
- reviewed
- Protein Names:
- Cysteine dioxygenase type 1 (EC 1.13.11.20) (Cysteine dioxygenase type I) (CDO) (CDO-I)
- Gene Names:
- CDO1
- Gene Names Primary:
- CDO1
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 200
- Sequence:
- MEQTEVLKPRTLADLIRILHQLFAGDEVNVEEVQAIMEAYESDPTEWAMYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTNSHCFLKMLQGNLKETLFAWPDKKSNEMVKKSERVLRENQCAYINDSIGLHRVENISHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTPNATSGSLENN
- Proteomes:
- UP000005640
Function
- Function:
- Initiates several important metabolic pathways related to pyruvate and several sulfurate compounds including sulfate, hypotaurine and taurine. Critical regulator of cellular cysteine concentrations. Has an important role in maintaining the hepatic concentation of intracellular free cysteine within a proper narrow range.
- Pathway:
- Organosulfur biosynthesis; taurine biosynthesis; hypotaurine from L-cysteine: step 1/2.
- Catalytic Activity:
- L-cysteine + O(2) = 3-sulfinoalanine.
- Cofactor:
- COFACTOR: Name=Fe(2+); Xref=ChEBI:CHEBI:29033; ; Note=Binds 1 Fe(2+) cation per subunit. Zn(2+) can be used to a much lesser extent.;
- Cross Reference Drug Bank:
- DB00151
- Gene Ontology Go:
- cytosol
cysteine dioxygenase activity
ferrous iron binding
cellular nitrogen compound metabolic process
cysteine metabolic process
inflammatory response
L-cysteine catabolic process
lactation
oxidation-reduction process
response to amino acid
response to cAMP
response to ethanol
response to glucagon
response to glucocorticoid
small molecule metabolic process
sulfur amino acid biosynthetic process
sulfur amino acid catabolic process
sulfur amino acid metabolic process
taurine biosynthetic process - Gene Ontology Biological Process:
- cellular nitrogen compound metabolic process
cysteine metabolic process
inflammatory response
lactation
L-cysteine catabolic process
oxidation-reduction process
response to amino acid
response to cAMP
response to ethanol
response to glucagon
response to glucocorticoid
small molecule metabolic process
sulfur amino acid biosynthetic process
sulfur amino acid catabolic process
sulfur amino acid metabolic process
taurine biosynthetic process - Gene Ontology Molecular Function:
- cysteine dioxygenase activity
ferrous iron binding - Gene Ontology Cellular Component:
- cytosol
- Keywords:
- 3D-structure
Complete proteome
Dioxygenase
Iron
Metal-binding
Oxidoreductase
Polymorphism
Reference proteome
Thioether bond