Names & Taxonomy
- Uniprot ID:
- Q16568
- Entry Name:
- CART_HUMAN
- Status:
- reviewed
- Protein Names:
- Cocaine- and amphetamine-regulated transcript protein [Cleaved into: CART(1-39); CART(42-89)]
- Gene Names:
- CARTPT CART
- Gene Names Primary:
- CARTPT
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 116
- Sequence:
- MESSRVRLLPLLGAALLLMLPLLGTRAQEDAELQPRALDIYSAVDDASHEKELIEALQEVLKKLKSKRVPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Secreted
Function
- Function:
- Satiety factor closely associated with the actions of leptin and neuropeptide y; this anorectic peptide inhibits both normal and starvation-induced feeding and completely blocks the feeding response induced by neuropeptide Y and regulated by leptin in the hypothalamus. It promotes neuronal development and survival in vitro.
- Cross Reference Drug Bank:
- DB00182
- Gene Ontology Go:
- extracellular space
secretory granule
activation of MAPKK activity
adult feeding behavior
cell-cell signaling
cellular glucose homeostasis
cellular response to starvation
circadian regulation of gene expression
G-protein coupled receptor signaling pathway
negative regulation of appetite
negative regulation of bone resorption
negative regulation of glucagon secretion
negative regulation of osteoclast differentiation
neuropeptide signaling pathway
positive regulation of blood pressure
positive regulation of epinephrine secretion
positive regulation of transmission of nerve impulse
regulation of insulin secretion
signal transduction
somatostatin secretion
synaptic transmission - Gene Ontology Biological Process:
- activation of MAPKK activity
adult feeding behavior
cell-cell signaling
cellular glucose homeostasis
cellular response to starvation
circadian regulation of gene expression
G-protein coupled receptor signaling pathway
negative regulation of appetite
negative regulation of bone resorption
negative regulation of glucagon secretion
negative regulation of osteoclast differentiation
neuropeptide signaling pathway
positive regulation of blood pressure
positive regulation of epinephrine secretion
positive regulation of transmission of nerve impulse
regulation of insulin secretion
signal transduction
somatostatin secretion
synaptic transmission - Gene Ontology Cellular Component:
- extracellular space
secretory granule - Keywords:
- 3D-structure
Cleavage on pair of basic residues
Complete proteome
Direct protein sequencing
Disulfide bond
Neuropeptide
Neurotransmitter
Obesity
Phosphoprotein
Polymorphism
Reference proteome
Secreted
Signal - Interacts With:
- P13688; P40199