Names & Taxonomy
- Uniprot ID:
- Q04828
- Entry Name:
- AK1C1_HUMAN
- Status:
- reviewed
- Protein Names:
- Aldo-keto reductase family 1 member C1 (EC 1.1.1.-) (20-alpha-hydroxysteroid dehydrogenase) (20-alpha-HSD) (EC 1.1.1.149) (Chlordecone reductase homolog HAKRC) (Dihydrodiol dehydrogenase 1/2) (DD1/DD2) (High-affinity hepatic bile acid-binding protein) (HBAB) (Indanol dehydrogenase) (EC 1.1.1.112) (Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase) (EC 1.3.1.20)
- Gene Names:
- AKR1C1 DDH DDH1
- Gene Names Primary:
- AKR1C1
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 323
- Sequence:
- MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAVEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Cytoplasm.
Function
- Function:
- Converts progesterone to its inactive form, 20-alpha-dihydroxyprogesterone (20-alpha-OHP). In the liver and intestine, may have a role in the transport of bile. May have a role in monitoring the intrahepatic bile acid concentration. Has a low bile-binding ability. May play a role in myelin formation.
- Catalytic Activity:
- 17-alpha,20-alpha-dihydroxypregn-4-en-3-one + NAD(P)(+) = 17-alpha-hydroxyprogesterone + NAD(P)H.
- Kinetics:
- BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=5 uM for (s)-tetralol
- Enzyme Regulation:
- ENZYME REGULATION: Inhibited by hexestrol with an IC(50) of 9.5 uM, 1,10-phenanthroline with an IC(50) of 55 uM, 1,7-phenanthroline with an IC(50) of 72 uM, flufenamic acid with an IC(50) of 6.0 uM, indomethacin with an IC(50) of 140 uM, ibuprofen with an IC(50) of 950 uM, lithocholic acid with an IC(50) of 25 uM, ursodeoxycholic acid with an IC(50) of 340 uM and chenodeoxycholic acid with an IC(50) of 570 uM.
- Active Site:
- ACT_SITE 55 55 Proton donor.
- Cross Reference Drug Bank:
- DB00945 DB00936
- Gene Ontology Go:
- cytosol
extracellular exosome
17-alpha,20-alpha-dihydroxypregn-4-en-3-one dehydrogenase activity
alditol:NADP+ 1-oxidoreductase activity
aldo-keto reductase (NADP) activity
androsterone dehydrogenase (B-specific) activity
bile acid binding
carboxylic acid binding
indanol dehydrogenase activity
ketosteroid monooxygenase activity
oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor
phenanthrene 9,10-monooxygenase activity
trans-1,2-dihydrobenzene-1,2-diol dehydrogenase activity
bile acid and bile salt transport
bile acid metabolic process
cellular response to jasmonic acid stimulus
cholesterol homeostasis
daunorubicin metabolic process
digestion
doxorubicin metabolic process
epithelial cell differentiation
fat-soluble vitamin metabolic process
intestinal cholesterol absorption
oxidation-reduction process
phototransduction, visible light
progesterone metabolic process
protein homooligomerization
response to organophosphorus
retinal metabolic process
retinoid metabolic process
small molecule metabolic process
vitamin metabolic process
xenobiotic metabolic process - Gene Ontology Biological Process:
- bile acid and bile salt transport
bile acid metabolic process
cellular response to jasmonic acid stimulus
cholesterol homeostasis
daunorubicin metabolic process
digestion
doxorubicin metabolic process
epithelial cell differentiation
fat-soluble vitamin metabolic process
intestinal cholesterol absorption
oxidation-reduction process
phototransduction, visible light
progesterone metabolic process
protein homooligomerization
response to organophosphorus
retinal metabolic process
retinoid metabolic process
small molecule metabolic process
vitamin metabolic process
xenobiotic metabolic process - Gene Ontology Molecular Function:
- 17-alpha,20-alpha-dihydroxypregn-4-en-3-one dehydrogenase activity
alditol:NADP+ 1-oxidoreductase activity
aldo-keto reductase (NADP) activity
androsterone dehydrogenase (B-specific) activity
bile acid binding
carboxylic acid binding
indanol dehydrogenase activity
ketosteroid monooxygenase activity
oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor
phenanthrene 9,10-monooxygenase activity
trans-1,2-dihydrobenzene-1,2-diol dehydrogenase activity - Gene Ontology Cellular Component:
- cytosol
extracellular exosome - Keywords:
- 3D-structure
Complete proteome
Cytoplasm
Direct protein sequencing
NADP
Oxidoreductase
Polymorphism
Reference proteome - Interacts With:
- P26045