Names & Taxonomy
- Uniprot ID:
- Q03181
- Entry Name:
- PPARD_HUMAN
- Status:
- reviewed
- Protein Names:
- Peroxisome proliferator-activated receptor delta (PPAR-delta) (NUCI) (Nuclear hormone receptor 1) (NUC1) (Nuclear receptor subfamily 1 group C member 2) (Peroxisome proliferator-activated receptor beta) (PPAR-beta)
- Gene Names:
- PPARD NR1C2 PPARB
- Gene Names Primary:
- PPARD
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 441
- Sequence:
- MEQPQEEAPEVREEEEKEEVAEAEGAPELNGGPQHALPSSSYTDLSRSSSPPSLLDQLQMGCDGASCGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCERSCKIQKKNRNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGLTANEGSQYNPQVADLKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKDMY
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Nucleus.
Function
- Function:
- Ligand-activated transcription factor. Receptor that binds peroxisome proliferators such as hypolipidemic drugs and fatty acids. Has a preference for poly-unsaturated fatty acids, such as gamma-linoleic acid and eicosapentanoic acid. Once activated by a ligand, the receptor binds to promoter elements of target genes. Regulates the peroxisomal beta-oxidation pathway of fatty acids. Functions as transcription activator for the acyl-CoA oxidase gene. Decreases expression of NPC1L1 once activated by a ligand.
- Cross Reference Drug Bank:
- DB01393 DB00159 DB00605 DB00374
- Gene Ontology Go:
- nuclear chromatin
nucleoplasm
nucleus
DNA binding
drug binding
linoleic acid binding
lipid binding
RNA polymerase II transcription factor activity, ligand-activated sequence-specific DNA binding
sequence-specific DNA binding
steroid hormone receptor activity
transcription coactivator activity
transcription factor activity, sequence-specific DNA binding
transcriptional repressor activity, RNA polymerase II transcription regulatory region sequence-specific binding
zinc ion binding
adipose tissue development
apoptotic process
apoptotic signaling pathway
axon ensheathment
cell differentiation
cell proliferation
cell-substrate adhesion
cellular response to hypoxia
cellular response to lipopolysaccharide
cholesterol metabolic process
decidualization
embryo implantation
fatty acid beta-oxidation
fatty acid catabolic process
fatty acid transport
gene expression
generation of precursor metabolites and energy
glucose metabolic process
glucose transport
heart development
intracellular receptor signaling pathway
keratinocyte migration
keratinocyte proliferation
lipid metabolic process
mRNA transcription
negative regulation of apoptotic process
negative regulation of cell growth
negative regulation of collagen biosynthetic process
negative regulation of epithelial cell proliferation
negative regulation of inflammatory response
negative regulation of myoblast differentiation
negative regulation of pri-miRNA transcription from RNA polymerase II promoter
negative regulation of smooth muscle cell migration
negative regulation of smooth muscle cell proliferation
negative regulation of transcription from RNA polymerase II promoter
negative regulation of transcription, DNA-templated
phospholipid biosynthetic process
positive regulation of epidermis development
positive regulation of fat cell differentiation
positive regulation of insulin secretion
positive regulation of myoblast proliferation
positive regulation of phosphatidylinositol 3-kinase signaling
positive regulation of skeletal muscle tissue regeneration
positive regulation of transcription, DNA-templated
positive regulation of vasodilation
proteoglycan metabolic process
regulation of skeletal muscle satellite cell proliferation
regulation of transcription from RNA polymerase II promoter
response to activity
response to glucose
response to vitamin A
transcription initiation from RNA polymerase II promoter
vitamin A metabolic process
wound healing - Gene Ontology Biological Process:
- adipose tissue development
apoptotic process
apoptotic signaling pathway
axon ensheathment
cell differentiation
cell proliferation
cell-substrate adhesion
cellular response to hypoxia
cellular response to lipopolysaccharide
cholesterol metabolic process
decidualization
embryo implantation
fatty acid beta-oxidation
fatty acid catabolic process
fatty acid transport
gene expression
generation of precursor metabolites and energy
glucose metabolic process
glucose transport
heart development
intracellular receptor signaling pathway
keratinocyte migration
keratinocyte proliferation
lipid metabolic process
mRNA transcription
negative regulation of apoptotic process
negative regulation of cell growth
negative regulation of collagen biosynthetic process
negative regulation of epithelial cell proliferation
negative regulation of inflammatory response
negative regulation of myoblast differentiation
negative regulation of pri-miRNA transcription from RNA polymerase II promoter
negative regulation of smooth muscle cell migration
negative regulation of smooth muscle cell proliferation
negative regulation of transcription, DNA-templated
negative regulation of transcription from RNA polymerase II promoter
phospholipid biosynthetic process
positive regulation of epidermis development
positive regulation of fat cell differentiation
positive regulation of insulin secretion
positive regulation of myoblast proliferation
positive regulation of phosphatidylinositol 3-kinase signaling
positive regulation of skeletal muscle tissue regeneration
positive regulation of transcription, DNA-templated
positive regulation of vasodilation
proteoglycan metabolic process
regulation of skeletal muscle satellite cell proliferation
regulation of transcription from RNA polymerase II promoter
response to activity
response to glucose
response to vitamin A
transcription initiation from RNA polymerase II promoter
vitamin A metabolic process
wound healing - Gene Ontology Molecular Function:
- DNA binding
drug binding
linoleic acid binding
lipid binding
RNA polymerase II transcription factor activity, ligand-activated sequence-specific DNA binding
sequence-specific DNA binding
steroid hormone receptor activity
transcriptional repressor activity, RNA polymerase II transcription regulatory region sequence-specific binding
transcription coactivator activity
transcription factor activity, sequence-specific DNA binding
zinc ion binding - Gene Ontology Cellular Component:
- nuclear chromatin
nucleoplasm
nucleus - Keywords:
- 3D-structure
Activator
Alternative splicing
Complete proteome
DNA-binding
Metal-binding
Nucleus
Receptor
Reference proteome
Transcription
Transcription regulation
Zinc
Zinc-finger - Interacts With:
- O60341; P60409