Names & Taxonomy
- Uniprot ID:
- Q02094
- Entry Name:
- RHAG_HUMAN
- Status:
- reviewed
- Protein Names:
- Ammonium transporter Rh type A (Erythrocyte membrane glycoprotein Rh50) (Erythrocyte plasma membrane 50 kDa glycoprotein) (Rh50A) (Rhesus blood group family type A glycoprotein) (Rh family type A glycoprotein) (Rh type A glycoprotein) (Rhesus blood group-associated ammonia channel) (Rhesus blood group-associated glycoprotein) (CD antigen CD241)
- Gene Names:
- RHAG RH50
- Gene Names Primary:
- RHAG
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 409
- Sequence:
- MRFTFPLMAIVLEIAMIVLFGLFVEYETDQTVLEQLNITKPTDMGIFFELYPLFQDVHVMIFVGFGFLMTFLKKYGFSSVGINLLVAALGLQWGTIVQGILQSQGQKFNIGIKNMINADFSAATVLISFGAVLGKTSPTQMLIMTILEIVFFAHNEYLVSEIFKASDIGASMTIHAFGAYFGLAVAGILYRSGLRKGHENEESAYYSDLFAMIGTLFLWMFWPSFNSAIAEPGDKQCRAIVNTYFSLAACVLTAFAFSSLVEHRGKLNMVHIQNATLAGGVAVGTCADMAIHPFGSMIIGSIAGMVSVLGYKFLTPLFTTKLRIHDTCGVHNLHGLPGVVGGLAGIVAVAMGASNTSMAMQAAALGSSIGTAVVGGLMTGLILKLPLWGQPSDQNCYDDSVYWKVPKTR
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Membrane; Multi-pass membrane protein.
Function
- Function:
- Associated with rhesus blood group antigen expression. May be part of an oligomeric complex which is likely to have a transport or channel function in the erythrocyte membrane.
- Gene Ontology Go:
- integral component of plasma membrane
plasma membrane
ammonium transmembrane transporter activity
ankyrin binding
ammonium transport
bicarbonate transport
carbon dioxide transport
cellular ion homeostasis
cellular response to nitrogen starvation
erythrocyte development
multicellular organismal iron ion homeostasis
nitrogen utilization
organic cation transport
small molecule metabolic process
transmembrane transport - Gene Ontology Biological Process:
- ammonium transport
bicarbonate transport
carbon dioxide transport
cellular ion homeostasis
cellular response to nitrogen starvation
erythrocyte development
multicellular organismal iron ion homeostasis
nitrogen utilization
organic cation transport
small molecule metabolic process
transmembrane transport - Gene Ontology Molecular Function:
- ammonium transmembrane transporter activity
ankyrin binding - Gene Ontology Cellular Component:
- integral component of plasma membrane
plasma membrane - Keywords:
- Alternative splicing
Ammonia transport
Complete proteome
Direct protein sequencing
Disease mutation
Glycoprotein
Membrane
Reference proteome
Transmembrane
Transmembrane helix
Transport