Names & Taxonomy
- Uniprot ID:
- P99999
- Entry Name:
- CYC_HUMAN
- Status:
- reviewed
- Protein Names:
- Cytochrome c
- Gene Names:
- CYCS CYC
- Gene Names Primary:
- CYCS
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 105
- Sequence:
- MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Mitochondrion intermembrane space. Note=Loosely associated with the inner membrane.
Function
- Function:
- Electron carrier protein. The oxidized form of the cytochrome c heme group can accept an electron from the heme group of the cytochrome c1 subunit of cytochrome reductase. Cytochrome c then transfers this electron to the cytochrome oxidase complex, the final protein carrier in the mitochondrial electron-transport chain.; Plays a role in apoptosis. Suppression of the anti-apoptotic members or activation of the pro-apoptotic members of the Bcl-2 family leads to altered mitochondrial membrane permeability resulting in release of cytochrome c into the cytosol. Binding of cytochrome c to Apaf-1 triggers the activation of caspase-9, which then accelerates apoptosis by activating other caspases.
- Cross Reference Drug Bank:
- DB01017
- Gene Ontology Go:
- cytosol
mitochondrial inner membrane
mitochondrial intermembrane space
mitochondrion
nucleus
protein phosphatase type 2A complex
respiratory chain
electron transporter, transferring electrons from CoQH2-cytochrome c reductase complex and cytochrome c oxidase complex activity
heme binding
metal ion binding
activation of cysteine-type endopeptidase activity involved in apoptotic process by cytochrome c
apoptotic process
cellular metabolic process
cellular respiration
gene expression
intrinsic apoptotic signaling pathway
mitochondrial electron transport, cytochrome c to oxygen
mitochondrial electron transport, ubiquinol to cytochrome c
mitochondrion organization
organelle organization
programmed cell death
protein dephosphorylation
respiratory electron transport chain
response to reactive oxygen species
small molecule metabolic process
transcription initiation from RNA polymerase II promoter - Gene Ontology Biological Process:
- activation of cysteine-type endopeptidase activity involved in apoptotic process by cytochrome c
apoptotic process
cellular metabolic process
cellular respiration
gene expression
intrinsic apoptotic signaling pathway
mitochondrial electron transport, cytochrome c to oxygen
mitochondrial electron transport, ubiquinol to cytochrome c
mitochondrion organization
organelle organization
programmed cell death
protein dephosphorylation
respiratory electron transport chain
response to reactive oxygen species
small molecule metabolic process
transcription initiation from RNA polymerase II promoter - Gene Ontology Molecular Function:
- electron transporter, transferring electrons from CoQH2-cytochrome c reductase complex and cytochrome c oxidase complex activity
heme binding
metal ion binding - Gene Ontology Cellular Component:
- cytosol
mitochondrial inner membrane
mitochondrial intermembrane space
mitochondrion
nucleus
protein phosphatase type 2A complex
respiratory chain - Keywords:
- 3D-structure
Acetylation
Apoptosis
Complete proteome
Direct protein sequencing
Disease mutation
Electron transport
Heme
Iron
Metal-binding
Mitochondrion
Phosphoprotein
Polymorphism
Reference proteome
Respiratory chain
Transport - Interacts With:
- O14727; Q07817; Q9FKS5; Q6A162