Names & Taxonomy
- Uniprot ID:
- P84077
- Entry Name:
- ARF1_HUMAN
- Status:
- reviewed
- Protein Names:
- ADP-ribosylation factor 1
- Gene Names:
- ARF1
- Gene Names Primary:
- ARF1
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 181
- Sequence:
- MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Golgi apparatus
Function
- Function:
- GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. Involved in protein trafficking among different compartments. Modulates vesicle budding and uncoating within the Golgi complex. Deactivation induces the redistribution of the entire Golgi complex to the endoplasmic reticulum, suggesting a crucial role in protein trafficking. In its GTP-bound form, its triggers the association with coat proteins with the Golgi membrane. The hydrolysis of ARF1-bound GTP, which is mediated by ARFGAPs proteins, is required for dissociation of coat proteins from Golgi membranes and vesicles. The GTP-bound form interacts with PICK1 to limit PICK1-mediated inhibition of Arp2/3 complex activity; the function is linked to AMPA receptor (AMPAR) trafficking, regulation of synaptic plasicity of excitatory synapses and spine shrinkage during long-term depression (LTD).
- Gene Ontology Go:
- cell leading edge
COPI-coated vesicle
cytosol
extracellular exosome
focal adhesion
Golgi membrane
late endosome
neuron projection
perinuclear region of cytoplasm
peroxisomal membrane
plasma membrane
postsynaptic density
postsynaptic membrane
sarcomere
trans-Golgi network
GDP binding
GTP binding
GTPase activity
magnesium ion binding
phospholipase D activator activity
poly(A) RNA binding
receptor signaling protein activity
actin filament organization
antigen processing and presentation of exogenous peptide antigen via MHC class II
cellular copper ion homeostasis
COPI coating of Golgi vesicle
dendritic spine organization
Golgi to transport vesicle transport
long term synaptic depression
lysosomal membrane organization
membrane organization
phosphatidylinositol biosynthetic process
phospholipid metabolic process
positive regulation of calcium ion-dependent exocytosis
positive regulation of dendritic spine development
positive regulation of endocytosis
positive regulation of ER to Golgi vesicle-mediated transport
positive regulation of late endosome to lysosome transport
positive regulation of protein secretion
positive regulation of sodium ion transmembrane transport
post-Golgi vesicle-mediated transport
protein transport
regulation of Arp2/3 complex-mediated actin nucleation
regulation of defense response to virus by virus
regulation of phospholipid metabolic process
regulation of receptor internalization
retrograde vesicle-mediated transport, Golgi to ER
small GTPase mediated signal transduction
small molecule metabolic process
synaptic vesicle budding
very-low-density lipoprotein particle assembly
viral process - Gene Ontology Biological Process:
- actin filament organization
antigen processing and presentation of exogenous peptide antigen via MHC class II
cellular copper ion homeostasis
COPI coating of Golgi vesicle
dendritic spine organization
Golgi to transport vesicle transport
long term synaptic depression
lysosomal membrane organization
membrane organization
phosphatidylinositol biosynthetic process
phospholipid metabolic process
positive regulation of calcium ion-dependent exocytosis
positive regulation of dendritic spine development
positive regulation of endocytosis
positive regulation of ER to Golgi vesicle-mediated transport
positive regulation of late endosome to lysosome transport
positive regulation of protein secretion
positive regulation of sodium ion transmembrane transport
post-Golgi vesicle-mediated transport
protein transport
regulation of Arp2/3 complex-mediated actin nucleation
regulation of defense response to virus by virus
regulation of phospholipid metabolic process
regulation of receptor internalization
retrograde vesicle-mediated transport, Golgi to ER
small GTPase mediated signal transduction
small molecule metabolic process
synaptic vesicle budding
very-low-density lipoprotein particle assembly
viral process - Gene Ontology Molecular Function:
- GDP binding
GTPase activity
GTP binding
magnesium ion binding
phospholipase D activator activity
poly(A) RNA binding
receptor signaling protein activity - Gene Ontology Cellular Component:
- cell leading edge
COPI-coated vesicle
cytosol
extracellular exosome
focal adhesion
Golgi membrane
late endosome
neuron projection
perinuclear region of cytoplasm
peroxisomal membrane
plasma membrane
postsynaptic density
postsynaptic membrane
sarcomere
trans-Golgi network - Keywords:
- 3D-structure
Acetylation
Cell junction
Cell membrane
Complete proteome
Cytoplasm
Direct protein sequencing
ER-Golgi transport
GTP-binding
Golgi apparatus
Lipoprotein
Membrane
Myristate
Nucleotide-binding
Postsynaptic cell membrane
Protein transport
Reference proteome
Synapse
Synaptosome
Transport - Interacts With:
- Q99418; O60271