Names & Taxonomy
- Uniprot ID:
- P79616
- Entry Name:
- P79616_HUMAN
- Status:
- unreviewed
- Protein Names:
- MHC class I HLA-A (Fragment)
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 91
- Sequence:
- SHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHAAEQQRAYLEGTCVEWLRRYLENGKETLQRT
Function
- Gene Ontology Go:
- MHC class I protein complex
peptide antigen binding
antigen processing and presentation of peptide antigen via MHC class I
immune response - Gene Ontology Biological Process:
- antigen processing and presentation of peptide antigen via MHC class I
immune response - Gene Ontology Molecular Function:
- peptide antigen binding
- Gene Ontology Cellular Component:
- MHC class I protein complex