Names & Taxonomy

Uniprot ID:
P63208
Entry Name:
SKP1_HUMAN
Status:
reviewed
Protein Names:
S-phase kinase-associated protein 1 (Cyclin-A/CDK2-associated protein p19) (p19A) (Organ of Corti protein 2) (OCP-2) (Organ of Corti protein II) (OCP-II) (RNA polymerase II elongation factor-like protein) (SIII) (Transcription elongation factor B polypeptide 1-like) (p19skp1)
Gene Names:
SKP1 EMC19 OCP2 SKP1A TCEB1L
Gene Names Primary:
SKP1
Organism:
Homo sapiens (Human)

Structure

Length:
163
Sequence:
MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK
Proteomes:
UP000005640

Function

Function:
Essential component of the SCF (SKP1-CUL1-F-box protein) ubiquitin ligase complex, which mediates the ubiquitination of proteins involved in cell cycle progression, signal transduction and transcription. In the SCF complex, serves as an adapter that links the F-box protein to CUL1. The functional specificity of the SCF complex depends on the F-box protein as substrate recognition component. SCF(BTRC) and SCF(FBXW11) direct ubiquitination of CTNNB1 and participate in Wnt signaling. SCF(FBXW11) directs ubiquitination of phosphorylated NFKBIA. SCF(BTRC) directs ubiquitination of NFKBIB, NFKBIE, ATF4, SMAD3, SMAD4, CDC25A, FBXO5, CEP68 and probably NFKB2 (PubMed:25704143). SCF(SKP2) directs ubiquitination of phosphorylated CDKN1B/p27kip and is involved in regulation of G1/S transition. SCF(SKP2) directs ubiquitination of ORC1, CDT1, RBL2, ELF4, CDKN1A, RAG2, FOXO1A, and probably MYC and TAL1. SCF(FBXW7) directs ubiquitination of cyclin E, NOTCH1 released notch intracellular domain (NICD), and probably PSEN1. SCF(FBXW2) directs ubiquitination of GCM1. SCF(FBXO32) directs ubiquitination of MYOD1. SCF(FBXO7) directs ubiquitination of BIRC2 and DLGAP5. SCF(FBXO33) directs ubiquitination of YBX1. SCF(FBXO11) directs ubiquitination of BCL6 and DTL but does not seem to direct ubiquitination of TP53. SCF(BTRC) mediates the ubiquitination of NFKBIA at 'Lys-21' and 'Lys-22'; the degradation frees the associated NFKB1-RELA dimer to translocate into the nucleus and to activate transcription. SCF(CCNF) directs ubiquitination of CCP110. SCF(FBXL3) and SCF(FBXL21) direct ubiquitination of CRY1 and CRY2. SCF(FBXO9) directs ubiquitination of TTI1 and TELO2. SCF(FBXO10) directs ubiquitination of BCL2.
Pathway:
Protein modification; protein ubiquitination.
Gene Ontology Go:
Cul7-RING ubiquitin ligase complex
cytoplasm
cytosol
extracellular exosome
nucleoplasm
nucleus
SCF ubiquitin ligase complex
beta-catenin binding
cullin family protein binding
ubiquitin-protein transferase activity
anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process
circadian rhythm
Fc-epsilon receptor signaling pathway
G1/S transition of mitotic cell cycle
G2/M transition of mitotic cell cycle
histone H2A monoubiquitination
innate immune response
mitotic cell cycle
MyD88-dependent toll-like receptor signaling pathway
MyD88-independent toll-like receptor signaling pathway
NIK/NF-kappaB signaling
Notch signaling pathway
positive regulation of ubiquitin-protein ligase activity involved in regulation of mitotic cell cycle transition
protein ubiquitination
regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle
SCF-dependent proteasomal ubiquitin-dependent protein catabolic process
stimulatory C-type lectin receptor signaling pathway
stress-activated MAPK cascade
T cell receptor signaling pathway
toll-like receptor 10 signaling pathway
toll-like receptor 2 signaling pathway
toll-like receptor 3 signaling pathway
toll-like receptor 4 signaling pathway
toll-like receptor 5 signaling pathway
toll-like receptor 9 signaling pathway
toll-like receptor signaling pathway
toll-like receptor TLR1:TLR2 signaling pathway
toll-like receptor TLR6:TLR2 signaling pathway
TRIF-dependent toll-like receptor signaling pathway
tumor necrosis factor-mediated signaling pathway
viral process
Gene Ontology Biological Process:
anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process
circadian rhythm
Fc-epsilon receptor signaling pathway
G1/S transition of mitotic cell cycle
G2/M transition of mitotic cell cycle
histone H2A monoubiquitination
innate immune response
mitotic cell cycle
MyD88-dependent toll-like receptor signaling pathway
MyD88-independent toll-like receptor signaling pathway
NIK/NF-kappaB signaling
Notch signaling pathway
positive regulation of ubiquitin-protein ligase activity involved in regulation of mitotic cell cycle transition
protein ubiquitination
regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle
SCF-dependent proteasomal ubiquitin-dependent protein catabolic process
stimulatory C-type lectin receptor signaling pathway
stress-activated MAPK cascade
T cell receptor signaling pathway
toll-like receptor 10 signaling pathway
toll-like receptor 2 signaling pathway
toll-like receptor 3 signaling pathway
toll-like receptor 4 signaling pathway
toll-like receptor 5 signaling pathway
toll-like receptor 9 signaling pathway
toll-like receptor signaling pathway
toll-like receptor TLR1:TLR2 signaling pathway
toll-like receptor TLR6:TLR2 signaling pathway
TRIF-dependent toll-like receptor signaling pathway
tumor necrosis factor-mediated signaling pathway
viral process
Gene Ontology Molecular Function:
beta-catenin binding
cullin family protein binding
ubiquitin-protein transferase activity
Gene Ontology Cellular Component:
Cul7-RING ubiquitin ligase complex
cytoplasm
cytosol
extracellular exosome
nucleoplasm
nucleus
SCF ubiquitin ligase complex
Keywords:
3D-structure
Alternative splicing
Complete proteome
Direct protein sequencing
Phosphoprotein
Polymorphism
Reference proteome
Ubl conjugation pathway
Interacts With:
Q96IX9; Q96GX9; Q9Y297; P41002; P38936; P35222; Q13616; Q8BFZ4; Q8C4V4; Q9UKA1; Q96CD0; Q86XK2; Q96EF6; Q9UK22; Q9NVF7; Q9UK99; Q9H4M3; Q6PJ61; Q9Y3I1; Q9UKB1; Q9UKT8; Q969U6; Q969H0; Q5XUX1; Q7L273; P25791; Q14901; P62136; Q13309; Q9Y2Z0-2; A0A0B4J1Y2; Q8N5M4

Publication

PubMed ID:
7553852 8530064 15489334 20068231 21269460 21406692 23431138 9031623 12481031 11389839 16880511 18203720 20596027 22113614 24275569 25704143 25503564 25944712 11099048 11961546 12820959 16209941 17434132 17389369 20181953