Names & Taxonomy
- Uniprot ID:
- P60953
- Entry Name:
- CDC42_HUMAN
- Status:
- reviewed
- Protein Names:
- Cell division control protein 42 homolog (G25K GTP-binding protein)
- Gene Names:
- CDC42
- Gene Names Primary:
- CDC42
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 191
- Sequence:
- MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Cell membrane
Function
- Function:
- Plasma membrane-associated small GTPase which cycles between an active GTP-bound and an inactive GDP-bound state. In active state binds to a variety of effector proteins to regulate cellular responses. Involved in epithelial cell polarization processes. Regulates the bipolar attachment of spindle microtubules to kinetochores before chromosome congression in metaphase. Plays a role in the extension and maintenance of the formation of thin, actin-rich surface projections called filopodia. Mediates CDC42-dependent cell migration.
- Enzyme Regulation:
- ENZYME REGULATION: Regulated by guanine nucleotide exchange factors (GEFs) which promote the exchange of bound GDP for free GTP, GTPase activating proteins (GAPs) which increase the GTP hydrolysis activity, and GDP dissociation inhibitors which inhibit the dissociation of the nucleotide from the GTPase.
- Gene Ontology Go:
- apical part of cell
cell-cell junction
cytoplasm
cytoplasmic ribonucleoprotein granule
cytosol
endoplasmic reticulum membrane
extracellular exosome
filopodium
focal adhesion
Golgi membrane
leading edge membrane
membrane
microtubule organizing center
midbody
mitotic spindle
myelin sheath
neuron projection
neuronal cell body
plasma membrane
secretory granule
spindle midzone
storage vacuole
apolipoprotein A-I receptor binding
GTP binding
GTPase activity
identical protein binding
protein kinase binding
thioesterase binding
ubiquitin protein ligase activity
actin cytoskeleton organization
actin filament branching
actin filament bundle assembly
adherens junction organization
axon guidance
blood coagulation
canonical Wnt signaling pathway
cardiac conduction system development
cellular protein localization
dendritic cell migration
ephrin receptor signaling pathway
epidermal growth factor receptor signaling pathway
epithelial cell-cell adhesion
epithelial-mesenchymal cell signaling
establishment of Golgi localization
establishment or maintenance of apical/basal cell polarity
establishment or maintenance of cell polarity
Fc-gamma receptor signaling pathway involved in phagocytosis
filopodium assembly
Golgi organization
hair follicle morphogenesis
hair follicle placode formation
heart contraction
innate immune response
keratinization
keratinocyte development
macrophage differentiation
multicellular organism growth
muscle cell differentiation
negative regulation of epidermal growth factor receptor signaling pathway
negative regulation of gene expression
negative regulation of protein complex assembly
neuron fate determination
nuclear migration
organelle transport along microtubule
positive regulation of cell growth
positive regulation of cytokinesis
positive regulation of DNA replication
positive regulation of epithelial cell proliferation involved in lung morphogenesis
positive regulation of gene expression
positive regulation of hair follicle cell proliferation
positive regulation of intracellular protein transport
positive regulation of JNK cascade
positive regulation of metalloenzyme activity
positive regulation of muscle cell differentiation
positive regulation of neuron apoptotic process
positive regulation of peptidyl-serine phosphorylation
positive regulation of phosphatidylinositol 3-kinase activity
positive regulation of pseudopodium assembly
positive regulation of substrate adhesion-dependent cell spreading
positive regulation of synapse structural plasticity
protein ubiquitination
regulation of attachment of spindle microtubules to kinetochore
regulation of filopodium assembly
regulation of mitotic nuclear division
regulation of protein catabolic process
regulation of protein heterodimerization activity
regulation of protein kinase activity
regulation of protein stability
regulation of small GTPase mediated signal transduction
small GTPase mediated signal transduction
sprouting angiogenesis
submandibular salivary gland formation
substantia nigra development
T cell costimulation
vascular endothelial growth factor receptor signaling pathway
Wnt signaling pathway, planar cell polarity pathway - Gene Ontology Biological Process:
- actin cytoskeleton organization
actin filament branching
actin filament bundle assembly
adherens junction organization
axon guidance
blood coagulation
canonical Wnt signaling pathway
cardiac conduction system development
cellular protein localization
dendritic cell migration
ephrin receptor signaling pathway
epidermal growth factor receptor signaling pathway
epithelial cell-cell adhesion
epithelial-mesenchymal cell signaling
establishment of Golgi localization
establishment or maintenance of apical/basal cell polarity
establishment or maintenance of cell polarity
Fc-gamma receptor signaling pathway involved in phagocytosis
filopodium assembly
Golgi organization
hair follicle morphogenesis
hair follicle placode formation
heart contraction
innate immune response
keratinization
keratinocyte development
macrophage differentiation
multicellular organism growth
muscle cell differentiation
negative regulation of epidermal growth factor receptor signaling pathway
negative regulation of gene expression
negative regulation of protein complex assembly
neuron fate determination
nuclear migration
organelle transport along microtubule
positive regulation of cell growth
positive regulation of cytokinesis
positive regulation of DNA replication
positive regulation of epithelial cell proliferation involved in lung morphogenesis
positive regulation of gene expression
positive regulation of hair follicle cell proliferation
positive regulation of intracellular protein transport
positive regulation of JNK cascade
positive regulation of metalloenzyme activity
positive regulation of muscle cell differentiation
positive regulation of neuron apoptotic process
positive regulation of peptidyl-serine phosphorylation
positive regulation of phosphatidylinositol 3-kinase activity
positive regulation of pseudopodium assembly
positive regulation of substrate adhesion-dependent cell spreading
positive regulation of synapse structural plasticity
protein ubiquitination
regulation of attachment of spindle microtubules to kinetochore
regulation of filopodium assembly
regulation of mitotic nuclear division
regulation of protein catabolic process
regulation of protein heterodimerization activity
regulation of protein kinase activity
regulation of protein stability
regulation of small GTPase mediated signal transduction
small GTPase mediated signal transduction
sprouting angiogenesis
submandibular salivary gland formation
substantia nigra development
T cell costimulation
vascular endothelial growth factor receptor signaling pathway
Wnt signaling pathway, planar cell polarity pathway - Gene Ontology Molecular Function:
- apolipoprotein A-I receptor binding
GTPase activity
GTP binding
identical protein binding
protein kinase binding
thioesterase binding
ubiquitin protein ligase activity - Gene Ontology Cellular Component:
- apical part of cell
cell-cell junction
cytoplasm
cytoplasmic ribonucleoprotein granule
cytosol
endoplasmic reticulum membrane
extracellular exosome
filopodium
focal adhesion
Golgi membrane
leading edge membrane
membrane
microtubule organizing center
midbody
mitotic spindle
myelin sheath
neuronal cell body
neuron projection
plasma membrane
secretory granule
spindle midzone
storage vacuole - Keywords:
- 3D-structure
Alternative splicing
Cell membrane
Complete proteome
Cytoplasm
Cytoskeleton
Differentiation
Direct protein sequencing
GTP-binding
Glycoprotein
Lipoprotein
Membrane
Methylation
Neurogenesis
Nucleotide-binding
Phosphoprotein
Prenylation
Reference proteome - Interacts With:
- Itself; O95477; Q07960; Q9UQB8; Q9UQB8-4; Q9VEX9; Q5VT25; Q00587; O14613; P46940; Q15811; Q5S007; Q16584; P45983; Q96L34; Q64096; Q13153; Q13177; O75914; Q61036; O96013; Q9NPB6; Q9BYG5; Q9JK83; Q9BYG4; P41743; A0A0H3NA16; O30916; O52623; Q07912; P42768; O00401; O08816
Publication
- PubMed ID:
- 2122236 2124704 16710414 15489334 8504089 2496687 7512369 10490598 10587647 10816584 10954424 11130076 11260256 11807099 12172552 14506284 12612085 14978216 15642749 17038317 19029984 19362538 19039103 20873783 21269460 21139582 23434736 24141704 25944712 9220962 9760238 9262406 10211824 19745154 20622875