Names & Taxonomy
- Uniprot ID:
- P52895
- Entry Name:
- AK1C2_HUMAN
- Status:
- reviewed
- Protein Names:
- Aldo-keto reductase family 1 member C2 (EC 1.-.-.-) (3-alpha-HSD3) (Chlordecone reductase homolog HAKRD) (Dihydrodiol dehydrogenase 2) (DD-2) (DD2) (Dihydrodiol dehydrogenase/bile acid-binding protein) (DD/BABP) (Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase) (EC 1.3.1.20) (Type III 3-alpha-hydroxysteroid dehydrogenase) (EC 1.1.1.357)
- Gene Names:
- AKR1C2 DDH2
- Gene Names Primary:
- AKR1C2
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 323
- Sequence:
- MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Cytoplasm
Function
- Function:
- Works in concert with the 5-alpha/5-beta-steroid reductases to convert steroid hormones into the 3-alpha/5-alpha and 3-alpha/5-beta-tetrahydrosteroids. Catalyzes the inactivation of the most potent androgen 5-alpha-dihydrotestosterone (5-alpha-DHT) to 5-alpha-androstane-3-alpha,17-beta-diol (3-alpha-diol). Has a high bile-binding ability.
- Catalytic Activity:
- Trans-1,2-dihydrobenzene-1,2-diol + NADP(+) = catechol + NADPH.
- Kinetics:
- BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=260 uM for (s)-tetralol
- Enzyme Regulation:
- ENZYME REGULATION: Inhibited by hexestrol with an IC(50) of 2.8 uM, 1,10-phenanthroline with an IC(50) of 2100 uM, 1,7-phenanthroline with an IC(50) of 1500 uM, flufenamic acid with an IC(50) of 0.9 uM, indomethacin with an IC(50) of 75 uM, ibuprofen with an IC(50) of 6.9 uM, lithocholic acid with an IC(50) of 0.07 uM, ursodeoxycholic acid with an IC(50) of 0.08 uM and chenodeoxycholic acid with an IC(50) of 0.13 uM.
- Active Site:
- ACT_SITE 55 55 Proton donor.
- Cross Reference Drug Bank:
- DB01586
- Gene Ontology Go:
- cytoplasm
alditol:NADP+ 1-oxidoreductase activity
bile acid binding
carboxylic acid binding
ketosteroid monooxygenase activity
oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor
phenanthrene 9,10-monooxygenase activity
trans-1,2-dihydrobenzene-1,2-diol dehydrogenase activity
cellular response to jasmonic acid stimulus
cellular response to prostaglandin D stimulus
daunorubicin metabolic process
digestion
doxorubicin metabolic process
epithelial cell differentiation
G-protein coupled receptor signaling pathway
oxidation-reduction process
positive regulation of cell proliferation
positive regulation of protein kinase B signaling
progesterone metabolic process
prostaglandin metabolic process
steroid metabolic process - Gene Ontology Biological Process:
- cellular response to jasmonic acid stimulus
cellular response to prostaglandin D stimulus
daunorubicin metabolic process
digestion
doxorubicin metabolic process
epithelial cell differentiation
G-protein coupled receptor signaling pathway
oxidation-reduction process
positive regulation of cell proliferation
positive regulation of protein kinase B signaling
progesterone metabolic process
prostaglandin metabolic process
steroid metabolic process - Gene Ontology Molecular Function:
- alditol:NADP+ 1-oxidoreductase activity
bile acid binding
carboxylic acid binding
ketosteroid monooxygenase activity
oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor
phenanthrene 9,10-monooxygenase activity
trans-1,2-dihydrobenzene-1,2-diol dehydrogenase activity - Gene Ontology Cellular Component:
- cytoplasm
- Keywords:
- 3D-structure
Alternative splicing
Complete proteome
Cytoplasm
Direct protein sequencing
Disease mutation
Lipid metabolism
NADP
Oxidoreductase
Polymorphism
Reference proteome
Steroid metabolism