Names & Taxonomy
- Uniprot ID:
- P51168
- Entry Name:
- SCNNB_HUMAN
- Status:
- reviewed
- Protein Names:
- Amiloride-sensitive sodium channel subunit beta (Beta-NaCH) (Epithelial Na(+) channel subunit beta) (Beta-ENaC) (ENaCB) (Nonvoltage-gated sodium channel 1 subunit beta) (SCNEB)
- Gene Names:
- SCNN1B
- Gene Names Primary:
- SCNN1B
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 640
- Sequence:
- MHVKKYLLKGLHRLQKGPGYTYKELLVWYCDNTNTHGPKRIICEGPKKKAMWFLLTLLFAALVCWQWGIFIRTYLSWEVSVSLSVGFKTMDFPAVTICNASPFKYSKIKHLLKDLDELMEAVLERILAPELSHANATRNLNFSIWNHTPLVLIDERNPHHPMVLDLFGDNHNGLTSSSASEKICNAHGCKMAMRLCSLNRTQCTFRNFTSATQALTEWYILQATNIFAQVPQQELVEMSYPGEQMILACLFGAEPCNYRNFTSIFYPHYGNCYIFNWGMTEKALPSANPGTEFGLKLILDIGQEDYVPFLASTAGVRLMLHEQRSYPFIRDEGIYAMSGTETSIGVLVDKLQRMGEPYSPCTVNGSEVPVQNFYSDYNTTYSIQACLRSCFQDHMIRNCNCGHYLYPLPRGEKYCNNRDFPDWAHCYSDLQMSVAQRETCIGMCKESCNDTQYKMTISMADWPSEASEDWIFHVLSQERDQSTNITLSRKGIVKLNIYFQEFNYRTIEESAANNIVWLLSNLGGQFGFWMGGSVLCLIEFGEIIIDFVWITIIKLVALAKSLRQRRAQASYAGPPPTVAELVEAHTNFGFQPDTAPRSPNTGPYPSEQALPIPGTPPPNYDSLRLQPLDVIESDSEGDAI
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Apical cell membrane
Function
- Function:
- Sodium permeable non-voltage-sensitive ion channel inhibited by the diuretic amiloride. Mediates the electrodiffusion of the luminal sodium (and water, which follows osmotically) through the apical membrane of epithelial cells. Plays an essential role in electrolyte and blood pressure homeostasis, but also in airway surface liquid homeostasis, which is important for proper clearance of mucus. Controls the reabsorption of sodium in kidney, colon, lung and sweat glands. Also plays a role in taste perception.
- Enzyme Regulation:
- ENZYME REGULATION: Activated by WNK1, WNK2, WNK3 and WNK4.
- Cross Reference Drug Bank:
- DB00594 DB00384
- Gene Ontology Go:
- apical plasma membrane
cytoplasmic vesicle membrane
external side of plasma membrane
extracellular exosome
integral component of plasma membrane
plasma membrane
sodium channel complex
ligand-gated sodium channel activity
WW domain binding
excretion
ion transmembrane transport
multicellular organismal water homeostasis
regulation of sodium ion transport
response to hypoxia
sensory perception of taste
sodium ion homeostasis
sodium ion transmembrane transport
sodium ion transport
transmembrane transport
wound healing, spreading of epidermal cells - Gene Ontology Biological Process:
- excretion
ion transmembrane transport
multicellular organismal water homeostasis
regulation of sodium ion transport
response to hypoxia
sensory perception of taste
sodium ion homeostasis
sodium ion transmembrane transport
sodium ion transport
transmembrane transport
wound healing, spreading of epidermal cells - Gene Ontology Molecular Function:
- ligand-gated sodium channel activity
WW domain binding - Gene Ontology Cellular Component:
- apical plasma membrane
cytoplasmic vesicle membrane
external side of plasma membrane
extracellular exosome
integral component of plasma membrane
plasma membrane
sodium channel complex - Keywords:
- Alternative splicing
Cell membrane
Complete proteome
Cytoplasmic vesicle
Disease mutation
Glycoprotein
Ion channel
Ion transport
Membrane
Phosphoprotein
Polymorphism
Reference proteome
Sensory transduction
Sodium
Sodium channel
Sodium transport
Taste
Transmembrane
Transmembrane helix
Transport - Interacts With:
- P46934
Publication
- PubMed ID:
- 7490094 7762608 9813171 12107247 15489334 10493829 7954808 1939532 7499195 9169421 11244092 12167593 16423824 18634878 20064610 22207244 22493497 24124190 23547933 24043776 26772908 7550319 8524790 8601645 8589714 9674649 9626162 9794716 10404817 12714866 15853823 16207733 15483078 16959974 18507830 19017867