Names & Taxonomy
- Uniprot ID:
- P48745
- Entry Name:
- NOV_HUMAN
- Status:
- reviewed
- Protein Names:
- Protein NOV homolog (NovH) (CCN family member 3) (Insulin-like growth factor-binding protein 9) (IBP-9) (IGF-binding protein 9) (IGFBP-9) (Nephroblastoma-overexpressed gene protein homolog)
- Gene Names:
- NOV CCN3 IGFBP9 NOVH
- Gene Names Primary:
- NOV
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 357
- Sequence:
- MQSVQSTSFCLRKQCLCLTFLLLHLLGQVAATQRCPPQCPGRCPATPPTCAPGVRAVLDGCSCCLVCARQRGESCSDLEPCDESSGLYCDRSADPSNQTGICTAVEGDNCVFDGVIYRSGEKFQPSCKFQCTCRDGQIGCVPRCQLDVLLPEPNCPAPRKVEVPGECCEKWICGPDEEDSLGGLTLAAYRPEATLGVEVSDSSVNCIEQTTEWTACSKSCGMGFSTRVTNRNRQCEMLKQTRLCMVRPCEQEPEQPTDKKGKKCLRTKKSLKAIHLQFKNCTSLHTYKPRFCGVCSDGRCCTPHNTKTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELELKTTRGKM
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Secreted. Cytoplasm
Function
- Function:
- Immediate-early protein playing a role in various cellular processes including proliferation, adhesion, migration, differentiation and survival (PubMed:15181016, PubMed:15611078, PubMed:12695522, PubMed:21344378, PubMed:12050162). Acts by binding to integrins or membrane receptors such as NOTCH1 (PubMed:12695522, PubMed:21344378, PubMed:15611078). Essential regulator of hematopoietic stem and progenitor cell function (PubMed:17463287). Inhibits myogenic differentiation through the activation of Notch-signaling pathway (PubMed:12050162). Inhibits vascular smooth muscle cells proliferation by increasing expression of cell-cycle regulators such as CDKN2B or CDKN1A independently of TGFB1 signaling (PubMed:20139355). Ligand of integrins ITGAV:ITGB3 and ITGA5:ITGB1, acts directly upon endothelial cells to stimulate pro-angiogenic activities and induces angiogenesis. In endothelial cells, supports cell adhesion, induces directed cell migration (chemotaxis) and promotes cell survival (PubMed:12695522). Plays also a role in cutaneous wound healing acting as integrin receptor ligand. Supports skin fibroblast adhesion through ITGA5:ITGB1 and ITGA6:ITGB1 and induces fibroblast chemotaxis through ITGAV:ITGB5. Seems to enhance bFGF-induced DNA synthesis in fibroblasts (PubMed:15611078). Involved in bone regeneration as a negative regulator (By similarity). Enhances the articular chondrocytic phenotype, whereas it repressed the one representing endochondral ossification (PubMed:21871891). Impairs pancreatic beta-cell function, inhibits beta-cell proliferation and insulin secretion (By similarity). Plays a role as negative regulator of endothelial pro-inflammatory activation reducing monocyte adhesion, its anti-inflammatory effects occur secondary to the inhibition of NF-kappaB signaling pathway (PubMed:21063504). Contributes to the control and coordination of inflammatory processes in atherosclerosis (By similarity). Attenuates inflammatory pain through regulation of IL1B- and TNF-induced MMP9, MMP2 and CCL2 expression. Inhibits MMP9 expression through ITGB1 engagement (PubMed:21871891).
- Cross Reference Drug Bank:
- DB00030
- Gene Ontology Go:
- axon
cytoplasm
dendrite
extracellular region
gap junction
intracellular membrane-bounded organelle
neuronal cell body
proteinaceous extracellular matrix
heparin binding
integrin binding
Notch binding
angiogenesis
bone regeneration
cell adhesion mediated by integrin
cell chemotaxis
cell-cell signaling
chondrocyte differentiation
endothelial cell chemotaxis
endothelial cell-cell adhesion
fibroblast migration
hematopoietic stem cell homeostasis
negative regulation of cell death
negative regulation of cell growth
negative regulation of chondrocyte proliferation
negative regulation of inflammatory response
negative regulation of insulin secretion
negative regulation of monocyte chemotaxis
negative regulation of myotube differentiation
negative regulation of NF-kappaB import into nucleus
negative regulation of sensory perception of pain
negative regulation of SMAD protein import into nucleus
positive regulation of Notch signaling pathway
regulation of gene expression
signal transduction
smooth muscle cell migration
smooth muscle cell proliferation
type B pancreatic cell proliferation - Gene Ontology Biological Process:
- angiogenesis
bone regeneration
cell adhesion mediated by integrin
cell-cell signaling
cell chemotaxis
chondrocyte differentiation
endothelial cell-cell adhesion
endothelial cell chemotaxis
fibroblast migration
hematopoietic stem cell homeostasis
negative regulation of cell death
negative regulation of cell growth
negative regulation of chondrocyte proliferation
negative regulation of inflammatory response
negative regulation of insulin secretion
negative regulation of monocyte chemotaxis
negative regulation of myotube differentiation
negative regulation of NF-kappaB import into nucleus
negative regulation of sensory perception of pain
negative regulation of SMAD protein import into nucleus
positive regulation of Notch signaling pathway
regulation of gene expression
signal transduction
smooth muscle cell migration
smooth muscle cell proliferation
type B pancreatic cell proliferation - Gene Ontology Molecular Function:
- heparin binding
integrin binding
Notch binding - Gene Ontology Cellular Component:
- axon
cytoplasm
dendrite
extracellular region
gap junction
intracellular membrane-bounded organelle
neuronal cell body
proteinaceous extracellular matrix - Keywords:
- Cell junction
Complete proteome
Cytoplasm
Direct protein sequencing
Disulfide bond
Gap junction
Glycoprotein
Growth factor
Polymorphism
Reference proteome
Secreted
Signal