Names & Taxonomy
- Uniprot ID:
- P29460
- Entry Name:
- IL12B_HUMAN
- Status:
- reviewed
- Protein Names:
- Interleukin-12 subunit beta (IL-12B) (Cytotoxic lymphocyte maturation factor 40 kDa subunit) (CLMF p40) (IL-12 subunit p40) (NK cell stimulatory factor chain 2) (NKSF2)
- Gene Names:
- IL12B NKSF2
- Gene Names Primary:
- IL12B
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 328
- Sequence:
- MCHQQLVISWFSLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Secreted.
Function
- Function:
- Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated killer cells, and stimulate the production of IFN-gamma by resting PBMC.
- Cross Reference Drug Bank:
- DB05679
- Gene Ontology Go:
- cytoplasm
extracellular space
interleukin-12 complex
interleukin-23 complex
membrane
cytokine receptor activity
identical protein binding
interleukin-12 alpha subunit binding
interleukin-12 receptor binding
protein heterodimerization activity
cell cycle arrest
cell migration
cellular response to interferon-gamma
cellular response to lipopolysaccharide
defense response to Gram-negative bacterium
defense response to protozoan
defense response to virus
interferon-gamma biosynthetic process
natural killer cell activation
natural killer cell activation involved in immune response
negative regulation of growth of symbiont in host
negative regulation of inflammatory response to antigenic stimulus
negative regulation of interleukin-10 production
negative regulation of interleukin-17 production
negative regulation of smooth muscle cell proliferation
positive regulation of activated T cell proliferation
positive regulation of activation of JAK2 kinase activity
positive regulation of cell adhesion
positive regulation of defense response to virus by host
positive regulation of granulocyte macrophage colony-stimulating factor production
positive regulation of inflammatory response
positive regulation of interferon-gamma biosynthetic process
positive regulation of interferon-gamma production
positive regulation of interleukin-10 production
positive regulation of interleukin-12 production
positive regulation of interleukin-17 production
positive regulation of lymphocyte proliferation
positive regulation of memory T cell differentiation
positive regulation of mononuclear cell proliferation
positive regulation of natural killer cell activation
positive regulation of natural killer cell mediated cytotoxicity directed against tumor cell target
positive regulation of natural killer cell proliferation
positive regulation of NF-kappaB import into nucleus
positive regulation of NK T cell activation
positive regulation of NK T cell proliferation
positive regulation of osteoclast differentiation
positive regulation of smooth muscle cell apoptotic process
positive regulation of T cell mediated cytotoxicity
positive regulation of T cell proliferation
positive regulation of T-helper 1 type immune response
positive regulation of T-helper 17 cell lineage commitment
positive regulation of T-helper 17 type immune response
positive regulation of tissue remodeling
positive regulation of tumor necrosis factor production
positive regulation of tyrosine phosphorylation of Stat3 protein
positive regulation of tyrosine phosphorylation of Stat4 protein
positive regulation of tyrosine phosphorylation of Stat5 protein
regulation of cytokine biosynthetic process
regulation of tyrosine phosphorylation of Stat1 protein
response to UV-B
sensory perception of pain
sexual reproduction
T-helper 1 type immune response
T-helper cell differentiation - Gene Ontology Biological Process:
- cell cycle arrest
cell migration
cellular response to interferon-gamma
cellular response to lipopolysaccharide
defense response to Gram-negative bacterium
defense response to protozoan
defense response to virus
interferon-gamma biosynthetic process
natural killer cell activation
natural killer cell activation involved in immune response
negative regulation of growth of symbiont in host
negative regulation of inflammatory response to antigenic stimulus
negative regulation of interleukin-10 production
negative regulation of interleukin-17 production
negative regulation of smooth muscle cell proliferation
positive regulation of activated T cell proliferation
positive regulation of activation of JAK2 kinase activity
positive regulation of cell adhesion
positive regulation of defense response to virus by host
positive regulation of granulocyte macrophage colony-stimulating factor production
positive regulation of inflammatory response
positive regulation of interferon-gamma biosynthetic process
positive regulation of interferon-gamma production
positive regulation of interleukin-10 production
positive regulation of interleukin-12 production
positive regulation of interleukin-17 production
positive regulation of lymphocyte proliferation
positive regulation of memory T cell differentiation
positive regulation of mononuclear cell proliferation
positive regulation of natural killer cell activation
positive regulation of natural killer cell mediated cytotoxicity directed against tumor cell target
positive regulation of natural killer cell proliferation
positive regulation of NF-kappaB import into nucleus
positive regulation of NK T cell activation
positive regulation of NK T cell proliferation
positive regulation of osteoclast differentiation
positive regulation of smooth muscle cell apoptotic process
positive regulation of T cell mediated cytotoxicity
positive regulation of T cell proliferation
positive regulation of T-helper 17 cell lineage commitment
positive regulation of T-helper 17 type immune response
positive regulation of T-helper 1 type immune response
positive regulation of tissue remodeling
positive regulation of tumor necrosis factor production
positive regulation of tyrosine phosphorylation of Stat3 protein
positive regulation of tyrosine phosphorylation of Stat4 protein
positive regulation of tyrosine phosphorylation of Stat5 protein
regulation of cytokine biosynthetic process
regulation of tyrosine phosphorylation of Stat1 protein
response to UV-B
sensory perception of pain
sexual reproduction
T-helper 1 type immune response
T-helper cell differentiation - Gene Ontology Molecular Function:
- cytokine receptor activity
identical protein binding
interleukin-12 alpha subunit binding
interleukin-12 receptor binding
protein heterodimerization activity - Gene Ontology Cellular Component:
- cytoplasm
extracellular space
interleukin-12 complex
interleukin-23 complex
membrane - Keywords:
- 3D-structure
Complete proteome
Cytokine
Direct protein sequencing
Disulfide bond
Glycoprotein
Immunoglobulin domain
Polymorphism
Reference proteome
Secreted
Signal - Interacts With:
- Itself; P29459; Q9NPF7; Q9EQ14