Names & Taxonomy
- Uniprot ID:
- P28161
- Entry Name:
- GSTM2_HUMAN
- Status:
- reviewed
- Protein Names:
- Glutathione S-transferase Mu 2 (EC 2.5.1.18) (GST class-mu 2) (GSTM2-2)
- Gene Names:
- GSTM2 GST4
- Gene Names Primary:
- GSTM2
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 218
- Sequence:
- MPMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGTHKITQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVWGNK
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Cytoplasm.
Function
- Function:
- Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.
- Catalytic Activity:
- RX + glutathione = HX + R-S-glutathione.
- Cross Reference Drug Bank:
- DB00143
- Gene Ontology Go:
- cytoplasm
cytosol
extracellular exosome
sarcoplasmic reticulum
enzyme binding
glutathione binding
glutathione transferase activity
protein homodimerization activity
receptor binding
cellular detoxification of nitrogen compound
cellular response to caffeine
glutathione derivative biosynthetic process
glutathione metabolic process
negative regulation of ryanodine-sensitive calcium-release channel activity
nitrobenzene metabolic process
positive regulation of ryanodine-sensitive calcium-release channel activity
regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion
regulation of release of sequestered calcium ion into cytosol by sarcoplasmic reticulum
regulation of skeletal muscle contraction by regulation of release of sequestered calcium ion
relaxation of cardiac muscle
small molecule metabolic process
xenobiotic catabolic process
xenobiotic metabolic process - Gene Ontology Biological Process:
- cellular detoxification of nitrogen compound
cellular response to caffeine
glutathione derivative biosynthetic process
glutathione metabolic process
negative regulation of ryanodine-sensitive calcium-release channel activity
nitrobenzene metabolic process
positive regulation of ryanodine-sensitive calcium-release channel activity
regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion
regulation of release of sequestered calcium ion into cytosol by sarcoplasmic reticulum
regulation of skeletal muscle contraction by regulation of release of sequestered calcium ion
relaxation of cardiac muscle
small molecule metabolic process
xenobiotic catabolic process
xenobiotic metabolic process - Gene Ontology Molecular Function:
- enzyme binding
glutathione binding
glutathione transferase activity
protein homodimerization activity
receptor binding - Gene Ontology Cellular Component:
- cytoplasm
cytosol
extracellular exosome
sarcoplasmic reticulum - Keywords:
- 3D-structure
Alternative splicing
Complete proteome
Cytoplasm
Direct protein sequencing
Phosphoprotein
Polymorphism
Reference proteome
Transferase