Names & Taxonomy
- Uniprot ID:
- P27797
- Entry Name:
- CALR_HUMAN
- Status:
- reviewed
- Protein Names:
- Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60)
- Gene Names:
- CALR CRTC
- Gene Names Primary:
- CALR
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 417
- Sequence:
- MLLSVPLLLGLLGLAVAEPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDEEKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Endoplasmic reticulum lumen
Function
- Function:
- Calcium-binding chaperone that promotes folding, oligomeric assembly and quality control in the endoplasmic reticulum (ER) via the calreticulin/calnexin cycle. This lectin interacts transiently with almost all of the monoglucosylated glycoproteins that are synthesized in the ER. Interacts with the DNA-binding domain of NR3C1 and mediates its nuclear export. Involved in maternal gene expression regulation. May participate in oocyte maturation via the regulation of calcium homeostasis (By similarity).
- Cross Reference Drug Bank:
- DB00025 DB01065 DB00031
- Gene Ontology Go:
- acrosomal vesicle
cell surface
cytoplasm
cytosol
endocytic vesicle lumen
endoplasmic reticulum
endoplasmic reticulum lumen
external side of plasma membrane
extracellular exosome
extracellular region
extracellular space
focal adhesion
Golgi apparatus
integral component of lumenal side of endoplasmic reticulum membrane
intracellular
membrane
MHC class I peptide loading complex
nucleus
perinuclear region of cytoplasm
polysome
proteinaceous extracellular matrix
sarcoplasmic reticulum lumen
smooth endoplasmic reticulum
androgen receptor binding
calcium ion binding
carbohydrate binding
chaperone binding
complement component C1q binding
DNA binding
glycoprotein binding
hormone binding
integrin binding
iron ion binding
mRNA binding
peptide binding
poly(A) RNA binding
protein binding involved in protein folding
ubiquitin protein ligase binding
unfolded protein binding
zinc ion binding
antigen processing and presentation of exogenous peptide antigen via MHC class I
antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent
antigen processing and presentation of peptide antigen via MHC class I
ATF6-mediated unfolded protein response
cardiac muscle cell differentiation
cell cycle arrest
cellular calcium ion homeostasis
cellular protein metabolic process
cellular response to lithium ion
cellular senescence
chaperone-mediated protein folding
cortical actin cytoskeleton organization
endoplasmic reticulum unfolded protein response
glucocorticoid receptor signaling pathway
negative regulation of intracellular steroid hormone receptor signaling pathway
negative regulation of neuron differentiation
negative regulation of retinoic acid receptor signaling pathway
negative regulation of transcription from RNA polymerase II promoter
negative regulation of transcription, DNA-templated
negative regulation of translation
peptide antigen assembly with MHC class I protein complex
positive regulation of cell cycle
positive regulation of cell proliferation
positive regulation of dendritic cell chemotaxis
positive regulation of DNA replication
positive regulation of gene expression
positive regulation of phagocytosis
positive regulation of substrate adhesion-dependent cell spreading
post-translational protein modification
protein export from nucleus
protein folding
protein folding in endoplasmic reticulum
protein localization to nucleus
protein maturation by protein folding
protein N-linked glycosylation via asparagine
protein stabilization
receptor-mediated endocytosis
regulation of apoptotic process
regulation of meiotic nuclear division
regulation of transcription, DNA-templated
response to drug
response to estradiol
response to testosterone
sequestering of calcium ion
spermatogenesis - Gene Ontology Biological Process:
- antigen processing and presentation of exogenous peptide antigen via MHC class I
antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent
antigen processing and presentation of peptide antigen via MHC class I
ATF6-mediated unfolded protein response
cardiac muscle cell differentiation
cell cycle arrest
cellular calcium ion homeostasis
cellular protein metabolic process
cellular response to lithium ion
cellular senescence
chaperone-mediated protein folding
cortical actin cytoskeleton organization
endoplasmic reticulum unfolded protein response
glucocorticoid receptor signaling pathway
negative regulation of intracellular steroid hormone receptor signaling pathway
negative regulation of neuron differentiation
negative regulation of retinoic acid receptor signaling pathway
negative regulation of transcription, DNA-templated
negative regulation of transcription from RNA polymerase II promoter
negative regulation of translation
peptide antigen assembly with MHC class I protein complex
positive regulation of cell cycle
positive regulation of cell proliferation
positive regulation of dendritic cell chemotaxis
positive regulation of DNA replication
positive regulation of gene expression
positive regulation of phagocytosis
positive regulation of substrate adhesion-dependent cell spreading
post-translational protein modification
protein export from nucleus
protein folding
protein folding in endoplasmic reticulum
protein localization to nucleus
protein maturation by protein folding
protein N-linked glycosylation via asparagine
protein stabilization
receptor-mediated endocytosis
regulation of apoptotic process
regulation of meiotic nuclear division
regulation of transcription, DNA-templated
response to drug
response to estradiol
response to testosterone
sequestering of calcium ion
spermatogenesis - Gene Ontology Molecular Function:
- androgen receptor binding
calcium ion binding
carbohydrate binding
chaperone binding
complement component C1q binding
DNA binding
glycoprotein binding
hormone binding
integrin binding
iron ion binding
mRNA binding
peptide binding
poly(A) RNA binding
protein binding involved in protein folding
ubiquitin protein ligase binding
unfolded protein binding
zinc ion binding - Gene Ontology Cellular Component:
- acrosomal vesicle
cell surface
cytoplasm
cytosol
endocytic vesicle lumen
endoplasmic reticulum
endoplasmic reticulum lumen
external side of plasma membrane
extracellular exosome
extracellular region
extracellular space
focal adhesion
Golgi apparatus
integral component of lumenal side of endoplasmic reticulum membrane
intracellular
membrane
MHC class I peptide loading complex
nucleus
perinuclear region of cytoplasm
polysome
proteinaceous extracellular matrix
sarcoplasmic reticulum lumen
smooth endoplasmic reticulum - Keywords:
- 3D-structure
Acetylation
Calcium
Chaperone
Complete proteome
Cytoplasm
Direct protein sequencing
Disulfide bond
Endoplasmic reticulum
Extracellular matrix
Glycoprotein
Lectin
Metal-binding
Reference proteome
Repeat
Sarcoplasmic reticulum
Secreted
Signal
Zinc - Interacts With:
- P05067; O95166; P04792; Q03518