Names & Taxonomy
- Uniprot ID:
- P25815
- Entry Name:
- S100P_HUMAN
- Status:
- reviewed
- Protein Names:
- Protein S100-P (Migration-inducing gene 9 protein) (MIG9) (Protein S100-E) (S100 calcium-binding protein P)
- Gene Names:
- S100P S100E
- Gene Names Primary:
- S100P
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 95
- Sequence:
- MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLK
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Nucleus. Cytoplasm. Cell projection, microvillus membrane. Note=Colocalizes with S100PBP in the nucleus. Colocolizes with EZR in the microvilli in a calcium-dependent manner.
Function
- Function:
- May function as calcium sensor and contribute to cellular calcium signaling. In a calcium-dependent manner, functions by interacting with other proteins, such as EZR and PPP5C, and indirectly plays a role in physiological processes like the formation of microvilli in epithelial cells. May stimulate cell proliferation in an autocrine manner via activation of the receptor for activated glycation end products (RAGE).
- Cross Reference Drug Bank:
- DB01003
- Gene Ontology Go:
- cytoplasm
extracellular exosome
microvillus membrane
nucleus
calcium ion binding
calcium-dependent protein binding
magnesium ion binding
endothelial cell migration
response to organic substance - Gene Ontology Biological Process:
- endothelial cell migration
response to organic substance - Gene Ontology Molecular Function:
- calcium-dependent protein binding
calcium ion binding
magnesium ion binding - Gene Ontology Cellular Component:
- cytoplasm
extracellular exosome
microvillus membrane
nucleus - Keywords:
- 3D-structure
Calcium
Cell membrane
Cell projection
Complete proteome
Cytoplasm
Direct protein sequencing
Membrane
Metal-binding
Nucleus
Reference proteome
Repeat - Interacts With:
- Q15109; Q9CXW3; P23297; P04271; Q9NYB0; Q9UBB9