Names & Taxonomy
- Uniprot ID:
- P18405
- Entry Name:
- S5A1_HUMAN
- Status:
- reviewed
- Protein Names:
- 3-oxo-5-alpha-steroid 4-dehydrogenase 1 (EC 1.3.1.22) (SR type 1) (Steroid 5-alpha-reductase 1) (S5AR 1)
- Gene Names:
- SRD5A1
- Gene Names Primary:
- SRD5A1
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 259
- Sequence:
- MATATGVAEERLLAALAYLQCAVGCAVFARNRQTNSVYGRHALPSHRLRVPARAAWVVQELPSLALPLYQYASESAPRLRSAPNCILLAMFLVHYGHRCLIYPFLMRGGKPMPLLACTMAIMFCTCNGYLQSRYLSHCAVYADDWVTDPRFLIGFGLWLTGMLINIHSDHILRNLRKPGDTGYKIPRGGLFEYVTAANYFGEIMEWCGYALASWSVQGAAFAFFTFCFLSGRAKEHHEWYLRKFEEYPKFRKIIIPFLF
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Microsome membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane
Function
- Function:
- Converts testosterone into 5-alpha-dihydrotestosterone and progesterone or corticosterone into their corresponding 5-alpha-3-oxosteroids. It plays a central role in sexual differentiation and androgen physiology.
- Catalytic Activity:
- A 3-oxo-5-alpha-steroid + NADP(+) = a 3-oxo-Delta(4)-steroid + NADPH.
- Cross Reference Drug Bank:
- DB01126 DB01216 DB00367 DB06412 DB00421
- Gene Ontology Go:
- cell body fiber
endoplasmic reticulum membrane
integral component of membrane
myelin sheath
neuronal cell body
perinuclear region of cytoplasm
3-oxo-5-alpha-steroid 4-dehydrogenase activity
amide binding
cholestenone 5-alpha-reductase activity
electron carrier activity
NADPH binding
androgen biosynthetic process
bone development
cell differentiation
cellular response to cAMP
cellular response to dexamethasone stimulus
cellular response to epinephrine stimulus
cellular response to estradiol stimulus
cellular response to growth factor stimulus
cellular response to insulin stimulus
cellular response to starvation
cellular response to testosterone stimulus
cerebral cortex development
circadian sleep/wake cycle, REM sleep
diterpenoid metabolic process
female genitalia development
hippocampus development
hypothalamus development
liver development
male genitalia development
male gonad development
pituitary gland development
progesterone metabolic process
response to drug
response to follicle-stimulating hormone
response to fungicide
response to growth hormone
response to muscle activity
serotonin metabolic process
sex determination
small molecule metabolic process
spinal cord development
steroid metabolic process
thalamus development
urogenital system development - Gene Ontology Biological Process:
- androgen biosynthetic process
bone development
cell differentiation
cellular response to cAMP
cellular response to dexamethasone stimulus
cellular response to epinephrine stimulus
cellular response to estradiol stimulus
cellular response to growth factor stimulus
cellular response to insulin stimulus
cellular response to starvation
cellular response to testosterone stimulus
cerebral cortex development
circadian sleep/wake cycle, REM sleep
diterpenoid metabolic process
female genitalia development
hippocampus development
hypothalamus development
liver development
male genitalia development
male gonad development
pituitary gland development
progesterone metabolic process
response to drug
response to follicle-stimulating hormone
response to fungicide
response to growth hormone
response to muscle activity
serotonin metabolic process
sex determination
small molecule metabolic process
spinal cord development
steroid metabolic process
thalamus development
urogenital system development - Gene Ontology Molecular Function:
- 3-oxo-5-alpha-steroid 4-dehydrogenase activity
amide binding
cholestenone 5-alpha-reductase activity
electron carrier activity
NADPH binding - Gene Ontology Cellular Component:
- cell body fiber
endoplasmic reticulum membrane
integral component of membrane
myelin sheath
neuronal cell body
perinuclear region of cytoplasm - Keywords:
- Complete proteome
Differentiation
Endoplasmic reticulum
Membrane
Microsome
NADP
Oxidoreductase
Reference proteome
Sexual differentiation
Transmembrane
Transmembrane helix