Names & Taxonomy
- Uniprot ID:
- P15692
- Entry Name:
- VEGFA_HUMAN
- Status:
- reviewed
- Protein Names:
- Vascular endothelial growth factor A (VEGF-A) (Vascular permeability factor) (VPF)
- Gene Names:
- VEGFA VEGF
- Gene Names Primary:
- VEGFA
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 232
- Sequence:
- MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSLPGPHPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Secreted
Function
- Function:
- Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. NRP1/Neuropilin-1 binds isoforms VEGF-165 and VEGF-145. Isoform VEGF165B binds to KDR but does not activate downstream signaling pathways, does not activate angiogenesis and inhibits tumor growth.
- Cross Reference Drug Bank:
- DB08885 DB00112 DB01136 DB06779 DB01120 DB01017 DB01270 DB03754 DB05294
- Gene Ontology Go:
- cell surface
cytoplasm
extracellular region
extracellular space
membrane
platelet alpha granule lumen
proteinaceous extracellular matrix
secretory granule
chemoattractant activity
cytokine activity
extracellular matrix binding
fibronectin binding
growth factor activity
heparin binding
identical protein binding
neuropilin binding
platelet-derived growth factor receptor binding
protein heterodimerization activity
protein homodimerization activity
receptor agonist activity
vascular endothelial growth factor receptor 1 binding
vascular endothelial growth factor receptor 2 binding
vascular endothelial growth factor receptor binding
activation of protein kinase activity
angiogenesis
artery morphogenesis
basophil chemotaxis
blood coagulation
branching morphogenesis of an epithelial tube
camera-type eye morphogenesis
cardiac muscle fiber development
cardiac vascular smooth muscle cell development
cell maturation
cell migration involved in sprouting angiogenesis
cellular response to hypoxia
cellular response to vascular endothelial growth factor stimulus
commissural neuron axon guidance
coronary artery morphogenesis
coronary vein morphogenesis
dopaminergic neuron differentiation
endothelial cell chemotaxis
epithelial cell differentiation
eye photoreceptor cell development
growth
heart morphogenesis
in utero embryonic development
induction of positive chemotaxis
kidney development
lactation
lung development
lymph vessel morphogenesis
macrophage differentiation
mammary gland alveolus development
mesoderm development
monocyte differentiation
negative regulation of apoptotic process
negative regulation of cysteine-type endopeptidase activity involved in apoptotic process
negative regulation of transcription from RNA polymerase II promoter
nervous system development
outflow tract morphogenesis
ovarian follicle development
patterning of blood vessels
platelet activation
platelet degranulation
positive chemotaxis
positive regulation of angiogenesis
positive regulation of axon extension involved in axon guidance
positive regulation of blood vessel endothelial cell migration
positive regulation of branching involved in ureteric bud morphogenesis
positive regulation of cell adhesion
positive regulation of cell division
positive regulation of cell migration
positive regulation of cell migration involved in sprouting angiogenesis
positive regulation of cell proliferation
positive regulation of cell proliferation by VEGF-activated platelet derived growth factor receptor signaling pathway
positive regulation of cellular component movement
positive regulation of CREB transcription factor activity
positive regulation of endothelial cell chemotaxis by VEGF-activated vascular endothelial growth factor receptor signaling pathway
positive regulation of endothelial cell migration
positive regulation of endothelial cell proliferation
positive regulation of epithelial cell proliferation
positive regulation of ERK1 and ERK2 cascade
positive regulation of focal adhesion assembly
positive regulation of gene expression
positive regulation of histone deacetylase activity
positive regulation of leukocyte migration
positive regulation of MAP kinase activity
positive regulation of mast cell chemotaxis
positive regulation of mesenchymal cell proliferation
positive regulation of neuroblast proliferation
positive regulation of p38MAPK cascade
positive regulation of peptidyl-serine phosphorylation
positive regulation of peptidyl-tyrosine autophosphorylation
positive regulation of peptidyl-tyrosine phosphorylation
positive regulation of positive chemotaxis
positive regulation of protein autophosphorylation
positive regulation of protein complex assembly
positive regulation of protein kinase C signaling
positive regulation of protein kinase D signaling
positive regulation of protein localization to early endosome
positive regulation of protein phosphorylation
positive regulation of receptor internalization
positive regulation of retinal ganglion cell axon guidance
positive regulation of transcription from RNA polymerase II promoter
positive regulation of transcription from RNA polymerase II promoter in response to hypoxia
positive regulation of vascular endothelial growth factor receptor signaling pathway
positive regulation of vascular permeability
post-embryonic camera-type eye development
primitive erythrocyte differentiation
regulation of cell shape
regulation of cGMP metabolic process
regulation of retinal ganglion cell axon guidance
regulation of transcription from RNA polymerase II promoter
regulation of transcription from RNA polymerase II promoter in response to hypoxia
response to hypoxia
surfactant homeostasis
tube formation
vascular endothelial growth factor receptor signaling pathway
vascular endothelial growth factor signaling pathway
vasculogenesis
VEGF-activated neuropilin signaling pathway - Gene Ontology Biological Process:
- activation of protein kinase activity
angiogenesis
artery morphogenesis
basophil chemotaxis
blood coagulation
branching morphogenesis of an epithelial tube
camera-type eye morphogenesis
cardiac muscle fiber development
cardiac vascular smooth muscle cell development
cell maturation
cell migration involved in sprouting angiogenesis
cellular response to hypoxia
cellular response to vascular endothelial growth factor stimulus
commissural neuron axon guidance
coronary artery morphogenesis
coronary vein morphogenesis
dopaminergic neuron differentiation
endothelial cell chemotaxis
epithelial cell differentiation
eye photoreceptor cell development
growth
heart morphogenesis
induction of positive chemotaxis
in utero embryonic development
kidney development
lactation
lung development
lymph vessel morphogenesis
macrophage differentiation
mammary gland alveolus development
mesoderm development
monocyte differentiation
negative regulation of apoptotic process
negative regulation of cysteine-type endopeptidase activity involved in apoptotic process
negative regulation of transcription from RNA polymerase II promoter
nervous system development
outflow tract morphogenesis
ovarian follicle development
patterning of blood vessels
platelet activation
platelet degranulation
positive chemotaxis
positive regulation of angiogenesis
positive regulation of axon extension involved in axon guidance
positive regulation of blood vessel endothelial cell migration
positive regulation of branching involved in ureteric bud morphogenesis
positive regulation of cell adhesion
positive regulation of cell division
positive regulation of cell migration
positive regulation of cell migration involved in sprouting angiogenesis
positive regulation of cell proliferation
positive regulation of cell proliferation by VEGF-activated platelet derived growth factor receptor signaling pathway
positive regulation of cellular component movement
positive regulation of CREB transcription factor activity
positive regulation of endothelial cell chemotaxis by VEGF-activated vascular endothelial growth factor receptor signaling pathway
positive regulation of endothelial cell migration
positive regulation of endothelial cell proliferation
positive regulation of epithelial cell proliferation
positive regulation of ERK1 and ERK2 cascade
positive regulation of focal adhesion assembly
positive regulation of gene expression
positive regulation of histone deacetylase activity
positive regulation of leukocyte migration
positive regulation of MAP kinase activity
positive regulation of mast cell chemotaxis
positive regulation of mesenchymal cell proliferation
positive regulation of neuroblast proliferation
positive regulation of p38MAPK cascade
positive regulation of peptidyl-serine phosphorylation
positive regulation of peptidyl-tyrosine autophosphorylation
positive regulation of peptidyl-tyrosine phosphorylation
positive regulation of positive chemotaxis
positive regulation of protein autophosphorylation
positive regulation of protein complex assembly
positive regulation of protein kinase C signaling
positive regulation of protein kinase D signaling
positive regulation of protein localization to early endosome
positive regulation of protein phosphorylation
positive regulation of receptor internalization
positive regulation of retinal ganglion cell axon guidance
positive regulation of transcription from RNA polymerase II promoter
positive regulation of transcription from RNA polymerase II promoter in response to hypoxia
positive regulation of vascular endothelial growth factor receptor signaling pathway
positive regulation of vascular permeability
post-embryonic camera-type eye development
primitive erythrocyte differentiation
regulation of cell shape
regulation of cGMP metabolic process
regulation of retinal ganglion cell axon guidance
regulation of transcription from RNA polymerase II promoter
regulation of transcription from RNA polymerase II promoter in response to hypoxia
response to hypoxia
surfactant homeostasis
tube formation
vascular endothelial growth factor receptor signaling pathway
vascular endothelial growth factor signaling pathway
vasculogenesis
VEGF-activated neuropilin signaling pathway - Gene Ontology Molecular Function:
- chemoattractant activity
cytokine activity
extracellular matrix binding
fibronectin binding
growth factor activity
heparin binding
identical protein binding
neuropilin binding
platelet-derived growth factor receptor binding
protein heterodimerization activity
protein homodimerization activity
receptor agonist activity
vascular endothelial growth factor receptor 1 binding
vascular endothelial growth factor receptor 2 binding
vascular endothelial growth factor receptor binding - Gene Ontology Cellular Component:
- cell surface
cytoplasm
extracellular region
extracellular space
membrane
platelet alpha granule lumen
proteinaceous extracellular matrix
secretory granule - Keywords:
- 3D-structure
Alternative initiation
Alternative promoter usage
Alternative splicing
Angiogenesis
Complete proteome
Developmental protein
Differentiation
Direct protein sequencing
Disulfide bond
Glycoprotein
Growth factor
Heparin-binding
Mitogen
Reference proteome
Secreted
Signal - Interacts With:
- Itself; P17948; P35968; O14786; O14786-2