Names & Taxonomy
- Uniprot ID:
- P15121
- Entry Name:
- ALDR_HUMAN
- Status:
- reviewed
- Protein Names:
- Aldose reductase (AR) (EC 1.1.1.21) (Aldehyde reductase) (Aldo-keto reductase family 1 member B1)
- Gene Names:
- AKR1B1 ALDR1
- Gene Names Primary:
- AKR1B1
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 316
- Sequence:
- MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Cytoplasm.
Function
- Function:
- Catalyzes the NADPH-dependent reduction of a wide variety of carbonyl-containing compounds to their corresponding alcohols with a broad range of catalytic efficiencies.
- Catalytic Activity:
- Alditol + NAD(P)(+) = aldose + NAD(P)H.
- Enzyme Regulation:
- ENZYME REGULATION: Cys-299 may regulate the kinetic and inhibition properties of the enzyme, but does not participate in catalysis.
- Active Site:
- ACT_SITE 49 49 Proton donor.
- Cross Reference Drug Bank:
- DB00605
- Gene Ontology Go:
- cell projection cytoplasm
cytoplasm
cytosol
extracellular exosome
extracellular space
mast cell granule
nucleoplasm
paranodal junction
perinuclear region of cytoplasm
Schmidt-Lanterman incisure
Schwann cell microvillus
alditol:NADP+ 1-oxidoreductase activity
aldo-keto reductase (NADP) activity
electron carrier activity
glyceraldehyde oxidoreductase activity
C21-steroid hormone biosynthetic process
carbohydrate metabolic process
cellular response to hydrogen peroxide
cellular response to methylglyoxal
cellular response to peptide
daunorubicin metabolic process
doxorubicin metabolic process
fructose biosynthetic process
fructose metabolic process
inner medullary collecting duct development
maternal process involved in female pregnancy
naphthalene metabolic process
norepinephrine metabolic process
positive regulation of JAK-STAT cascade
positive regulation of smooth muscle cell proliferation
response to stress
response to thyroid hormone
response to water deprivation
small molecule metabolic process
sorbitol biosynthetic process
steroid metabolic process
stress-activated protein kinase signaling cascade
tissue homeostasis - Gene Ontology Biological Process:
- C21-steroid hormone biosynthetic process
carbohydrate metabolic process
cellular response to hydrogen peroxide
cellular response to methylglyoxal
cellular response to peptide
daunorubicin metabolic process
doxorubicin metabolic process
fructose biosynthetic process
fructose metabolic process
inner medullary collecting duct development
maternal process involved in female pregnancy
naphthalene metabolic process
norepinephrine metabolic process
positive regulation of JAK-STAT cascade
positive regulation of smooth muscle cell proliferation
response to stress
response to thyroid hormone
response to water deprivation
small molecule metabolic process
sorbitol biosynthetic process
steroid metabolic process
stress-activated protein kinase signaling cascade
tissue homeostasis - Gene Ontology Molecular Function:
- alditol:NADP+ 1-oxidoreductase activity
aldo-keto reductase (NADP) activity
electron carrier activity
glyceraldehyde oxidoreductase activity - Gene Ontology Cellular Component:
- cell projection cytoplasm
cytoplasm
cytosol
extracellular exosome
extracellular space
mast cell granule
nucleoplasm
paranodal junction
perinuclear region of cytoplasm
Schmidt-Lanterman incisure
Schwann cell microvillus - Keywords:
- 3D-structure
Acetylation
Complete proteome
Cytoplasm
Direct protein sequencing
NADP
Oxidoreductase
Phosphoprotein
Polymorphism
Reference proteome