Names & Taxonomy
- Uniprot ID:
- P13631
- Entry Name:
- RARG_HUMAN
- Status:
- reviewed
- Protein Names:
- Retinoic acid receptor gamma (RAR-gamma) (Nuclear receptor subfamily 1 group B member 3)
- Gene Names:
- RARG NR1B3
- Gene Names Primary:
- RARG
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 454
- Sequence:
- MATNKERLFAAGALGPGSGYPGAGFPFAFPGALRGSPPFEMLSPSFRGLGQPDLPKEMASLSVETQSTSSEEMVPSSPSPPPPPRVYKPCFVCNDKSSGYHYGVSSCEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKEAVRNDRNKKKKEVKEEGSPDSYELSPQLEELITKVSKAHQETFPSLCQLGKYTTNSSADHRVQLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLSIADQITLLKAACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKVDKLQEPLLEALRLYARRRRPSQPYMFPRMLMKITDLRGISTKGAERAITLKMEIPGPMPPLIREMLENPEMFEDDSSQPGPHPNASSEDEVPGGQGKGGLKSPA
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Nucleus.
Function
- Function:
- Receptor for retinoic acid. Retinoic acid receptors bind as heterodimers to their target response elements in response to their ligands, all-trans or 9-cis retinoic acid, and regulate gene expression in various biological processes. The RAR/RXR heterodimers bind to the retinoic acid response elements (RARE) composed of tandem 5'-AGGTCA-3' sites known as DR1-DR5. In the absence of ligand, acts mainly as an activator of gene expression due to weak binding to corepressors. Required for limb bud development. In concert with RARA or RARB, required for skeletal growth, matrix homeostasis and growth plate function (By similarity).
- Cross Reference Drug Bank:
- DB00459 DB00210 DB00523 DB00799 DB00755
- Gene Ontology Go:
- integral component of membrane
nuclear chromatin
nucleoplasm
nucleus
transcription factor complex
DNA binding
retinoic acid receptor activity
retinoid X receptor binding
RNA polymerase II regulatory region sequence-specific DNA binding
steroid hormone receptor activity
transcription factor activity, sequence-specific DNA binding
zinc ion binding
anterior/posterior pattern specification
canonical Wnt signaling pathway
cellular response to retinoic acid
embryonic camera-type eye development
embryonic eye morphogenesis
embryonic hindlimb morphogenesis
face development
gene expression
glandular epithelial cell development
growth plate cartilage chondrocyte growth
Harderian gland development
multicellular organism growth
negative regulation of apoptotic process
negative regulation of cell proliferation
negative regulation of chondrocyte differentiation
negative regulation of transcription from RNA polymerase II promoter
neural tube closure
positive regulation of apoptotic process
positive regulation of cell proliferation
positive regulation of programmed cell death
positive regulation of transcription from RNA polymerase II promoter
prostate gland epithelium morphogenesis
regulation of cell size
regulation of myelination
regulation of myeloid cell differentiation
response to retinoic acid
retinal pigment epithelium development
retinoic acid receptor signaling pathway
trachea cartilage development
transcription initiation from RNA polymerase II promoter - Gene Ontology Biological Process:
- anterior/posterior pattern specification
canonical Wnt signaling pathway
cellular response to retinoic acid
embryonic camera-type eye development
embryonic eye morphogenesis
embryonic hindlimb morphogenesis
face development
gene expression
glandular epithelial cell development
growth plate cartilage chondrocyte growth
Harderian gland development
multicellular organism growth
negative regulation of apoptotic process
negative regulation of cell proliferation
negative regulation of chondrocyte differentiation
negative regulation of transcription from RNA polymerase II promoter
neural tube closure
positive regulation of apoptotic process
positive regulation of cell proliferation
positive regulation of programmed cell death
positive regulation of transcription from RNA polymerase II promoter
prostate gland epithelium morphogenesis
regulation of cell size
regulation of myelination
regulation of myeloid cell differentiation
response to retinoic acid
retinal pigment epithelium development
retinoic acid receptor signaling pathway
trachea cartilage development
transcription initiation from RNA polymerase II promoter - Gene Ontology Molecular Function:
- DNA binding
retinoic acid receptor activity
retinoid X receptor binding
RNA polymerase II regulatory region sequence-specific DNA binding
steroid hormone receptor activity
transcription factor activity, sequence-specific DNA binding
zinc ion binding - Gene Ontology Cellular Component:
- integral component of membrane
nuclear chromatin
nucleoplasm
nucleus
transcription factor complex - Keywords:
- 3D-structure
Alternative splicing
Complete proteome
DNA-binding
Metal-binding
Nucleus
Polymorphism
Receptor
Reference proteome
Transcription
Transcription regulation
Zinc
Zinc-finger - Interacts With:
- O60504-2