Names & Taxonomy
- Uniprot ID:
- P10176
- Entry Name:
- COX8A_HUMAN
- Status:
- reviewed
- Protein Names:
- Cytochrome c oxidase subunit 8A, mitochondrial (Cytochrome c oxidase polypeptide VIII-liver/heart) (Cytochrome c oxidase subunit 8-2)
- Gene Names:
- COX8A COX8 COX8L
- Gene Names Primary:
- COX8A
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 69
- Sequence:
- MSVLTPLLLRGLTGSARRLPVPRAKIHSLPPEGKLGIMELAVGLTSCFVTFLLPAGWILSHLETYRRPE
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Mitochondrion inner membrane.
Function
- Function:
- This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.
- Cross Reference Drug Bank:
- DB02659
- Gene Ontology Go:
- integral component of membrane
mitochondrial inner membrane
mitochondrial respiratory chain complex IV
cytochrome-c oxidase activity
cellular metabolic process
gene expression
generation of precursor metabolites and energy
hydrogen ion transmembrane transport
mitochondrial electron transport, cytochrome c to oxygen
mitophagy in response to mitochondrial depolarization
positive regulation of defense response to virus by host
respiratory electron transport chain
small molecule metabolic process
transcription initiation from RNA polymerase II promoter
xenophagy - Gene Ontology Biological Process:
- cellular metabolic process
gene expression
generation of precursor metabolites and energy
hydrogen ion transmembrane transport
mitochondrial electron transport, cytochrome c to oxygen
mitophagy in response to mitochondrial depolarization
positive regulation of defense response to virus by host
respiratory electron transport chain
small molecule metabolic process
transcription initiation from RNA polymerase II promoter
xenophagy - Gene Ontology Molecular Function:
- cytochrome-c oxidase activity
- Gene Ontology Cellular Component:
- integral component of membrane
mitochondrial inner membrane
mitochondrial respiratory chain complex IV - Keywords:
- Complete proteome
Direct protein sequencing
Membrane
Mitochondrion
Mitochondrion inner membrane
Reference proteome
Transit peptide
Transmembrane
Transmembrane helix - Interacts With:
- P06748