Names & Taxonomy
- Uniprot ID:
- P09211
- Entry Name:
- GSTP1_HUMAN
- Status:
- reviewed
- Protein Names:
- Glutathione S-transferase P (EC 2.5.1.18) (GST class-pi) (GSTP1-1)
- Gene Names:
- GSTP1 FAEES3 GST3
- Gene Names Primary:
- GSTP1
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 210
- Sequence:
- MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Cytoplasm
Function
- Function:
- Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Regulates negatively CDK5 activity via p25/p35 translocation to prevent neurodegeneration.
- Catalytic Activity:
- RX + glutathione = HX + R-S-glutathione.
- Cross Reference Drug Bank:
- DB01008 DB04339 DB00958 DB00291 DB00515 DB01242 DB00773 DB00143 DB00526 DB00163
- Gene Ontology Go:
- cytoplasm
cytosol
extracellular exosome
extracellular space
intracellular
mitochondrion
nucleus
plasma membrane
TRAF2-GSTP1 complex
vesicle
dinitrosyl-iron complex binding
drug binding
glutathione binding
glutathione transferase activity
JUN kinase binding
kinase regulator activity
nitric oxide binding
S-nitrosoglutathione binding
cellular response to cell-matrix adhesion
cellular response to epidermal growth factor stimulus
cellular response to glucocorticoid stimulus
cellular response to insulin stimulus
cellular response to lipopolysaccharide
central nervous system development
common myeloid progenitor cell proliferation
glutathione derivative biosynthetic process
glutathione metabolic process
negative regulation of acute inflammatory response
negative regulation of apoptotic process
negative regulation of biosynthetic process
negative regulation of ERK1 and ERK2 cascade
negative regulation of extrinsic apoptotic signaling pathway
negative regulation of fibroblast proliferation
negative regulation of I-kappaB kinase/NF-kappaB signaling
negative regulation of interleukin-1 beta production
negative regulation of JUN kinase activity
negative regulation of leukocyte proliferation
negative regulation of MAP kinase activity
negative regulation of MAPK cascade
negative regulation of monocyte chemotactic protein-1 production
negative regulation of nitric-oxide synthase biosynthetic process
negative regulation of protein kinase activity
negative regulation of stress-activated MAPK cascade
negative regulation of tumor necrosis factor production
negative regulation of tumor necrosis factor-mediated signaling pathway
nitric oxide storage
oligodendrocyte development
organ regeneration
positive regulation of superoxide anion generation
regulation of ERK1 and ERK2 cascade
regulation of stress-activated MAPK cascade
response to amino acid
response to estradiol
response to ethanol
response to L-ascorbic acid
response to mercury ion
response to reactive oxygen species
response to toxic substance
small molecule metabolic process
xenobiotic metabolic process - Gene Ontology Biological Process:
- cellular response to cell-matrix adhesion
cellular response to epidermal growth factor stimulus
cellular response to glucocorticoid stimulus
cellular response to insulin stimulus
cellular response to lipopolysaccharide
central nervous system development
common myeloid progenitor cell proliferation
glutathione derivative biosynthetic process
glutathione metabolic process
negative regulation of acute inflammatory response
negative regulation of apoptotic process
negative regulation of biosynthetic process
negative regulation of ERK1 and ERK2 cascade
negative regulation of extrinsic apoptotic signaling pathway
negative regulation of fibroblast proliferation
negative regulation of I-kappaB kinase/NF-kappaB signaling
negative regulation of interleukin-1 beta production
negative regulation of JUN kinase activity
negative regulation of leukocyte proliferation
negative regulation of MAPK cascade
negative regulation of MAP kinase activity
negative regulation of monocyte chemotactic protein-1 production
negative regulation of nitric-oxide synthase biosynthetic process
negative regulation of protein kinase activity
negative regulation of stress-activated MAPK cascade
negative regulation of tumor necrosis factor-mediated signaling pathway
negative regulation of tumor necrosis factor production
nitric oxide storage
oligodendrocyte development
organ regeneration
positive regulation of superoxide anion generation
regulation of ERK1 and ERK2 cascade
regulation of stress-activated MAPK cascade
response to amino acid
response to estradiol
response to ethanol
response to L-ascorbic acid
response to mercury ion
response to reactive oxygen species
response to toxic substance
small molecule metabolic process
xenobiotic metabolic process - Gene Ontology Molecular Function:
- dinitrosyl-iron complex binding
drug binding
glutathione binding
glutathione transferase activity
JUN kinase binding
kinase regulator activity
nitric oxide binding
S-nitrosoglutathione binding - Gene Ontology Cellular Component:
- cytoplasm
cytosol
extracellular exosome
extracellular space
intracellular
mitochondrion
nucleus
plasma membrane
TRAF2-GSTP1 complex
vesicle - Keywords:
- 3D-structure
Acetylation
Complete proteome
Cytoplasm
Direct protein sequencing
Mitochondrion
Nucleus
Phosphoprotein
Polymorphism
Reference proteome
Transferase - Interacts With:
- Q92624; Q15323; P60409; P60411; Q7Z3S9; P30041; Q12933