Names & Taxonomy
- Uniprot ID:
- P08174
- Entry Name:
- DAF_HUMAN
- Status:
- reviewed
- Protein Names:
- Complement decay-accelerating factor (CD antigen CD55)
- Gene Names:
- CD55 CR DAF
- Gene Names Primary:
- CD55
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 381
- Sequence:
- MTVARPSVPAALPLLGELPRLLLLVLLCLPAVWGDCGLPPDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYRREPSLSPKLTCLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPGGILFGATISFSCNTGYKLFGSTSSFCLISGSSVQWSDPLPECREIYCPAPPQIDNGIIQGERDHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDEGEWSGPPPECRGKSLTSKVPPTVQKPTTVNVPTTEVSPTSQKTTTKTTTPNAQATRSTPVSRTTKHFHETTPNKGSGTTSGTTRLLSGHTCFTLTGLLGTLVTMGLLT
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Isoform 1: Cell membrane; Single-pass type I membrane protein.; Isoform 2: Cell membrane; Lipid-anchor, GPI-anchor.; Isoform 3: Secreted
Function
- Function:
- This protein recognizes C4b and C3b fragments that condense with cell-surface hydroxyl or amino groups when nascent C4b and C3b are locally generated during C4 and c3 activation. Interaction of daf with cell-associated C4b and C3b polypeptides interferes with their ability to catalyze the conversion of C2 and factor B to enzymatically active C2a and Bb and thereby prevents the formation of C4b2a and C3bBb, the amplification convertases of the complement cascade.
- Cross Reference Drug Bank:
- DB00446
- Gene Ontology Go:
- anchored component of membrane
cell surface
endoplasmic reticulum-Golgi intermediate compartment membrane
extracellular exosome
extracellular region
Golgi membrane
integral component of plasma membrane
membrane raft
plasma membrane
transport vesicle
lipid binding
virus receptor activity
CD4-positive, alpha-beta T cell cytokine production
cellular protein metabolic process
complement activation, classical pathway
ER to Golgi vesicle-mediated transport
innate immune response
membrane organization
negative regulation of complement activation
positive regulation of CD4-positive, alpha-beta T cell activation
positive regulation of CD4-positive, alpha-beta T cell proliferation
positive regulation of cytosolic calcium ion concentration
post-translational protein modification
protein N-linked glycosylation via asparagine
regulation of complement activation
regulation of lipopolysaccharide-mediated signaling pathway
respiratory burst
viral entry into host cell - Gene Ontology Biological Process:
- CD4-positive, alpha-beta T cell cytokine production
cellular protein metabolic process
complement activation, classical pathway
ER to Golgi vesicle-mediated transport
innate immune response
membrane organization
negative regulation of complement activation
positive regulation of CD4-positive, alpha-beta T cell activation
positive regulation of CD4-positive, alpha-beta T cell proliferation
positive regulation of cytosolic calcium ion concentration
post-translational protein modification
protein N-linked glycosylation via asparagine
regulation of complement activation
regulation of lipopolysaccharide-mediated signaling pathway
respiratory burst
viral entry into host cell - Gene Ontology Molecular Function:
- lipid binding
virus receptor activity - Gene Ontology Cellular Component:
- anchored component of membrane
cell surface
endoplasmic reticulum-Golgi intermediate compartment membrane
extracellular exosome
extracellular region
Golgi membrane
integral component of plasma membrane
membrane raft
plasma membrane
transport vesicle - Keywords:
- 3D-structure
Alternative splicing
Blood group antigen
Cell membrane
Complement pathway
Complete proteome
Direct protein sequencing
Disulfide bond
GPI-anchor
Glycoprotein
Host cell receptor for virus entry
Host-virus interaction
Immunity
Innate immunity
Lipoprotein
Membrane
Polymorphism
Receptor
Reference proteome
Repeat
Secreted
Signal
Sushi