Names & Taxonomy
- Uniprot ID:
- P05019
- Entry Name:
- IGF1_HUMAN
- Status:
- reviewed
- Protein Names:
- Insulin-like growth factor I (IGF-I) (Mechano growth factor) (MGF) (Somatomedin-C)
- Gene Names:
- IGF1 IBP1
- Gene Names Primary:
- IGF1
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 195
- Sequence:
- MGKISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKYQPPSTNKNTKSQRRKGWPKTHPGGEQKEGTEASLQIRGKKKEQRREIGSRNAECRGKKGK
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Secreted
Function
- Function:
- The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity. May be a physiological regulator of -2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts. Stimulates glucose transport in bone-derived osteoblastic (PyMS) cells and is effective at much lower concentrations than insulin, not only regarding glycogen and DNA synthesis but also with regard to enhancing glucose uptake. May play a role in synapse maturation (PubMed:21076856, PubMed:24132240). Ca(2+)-dependent exocytosis of IGF1 is required for sensory perception of smell in the olfactory bulb (By similarity).
- Gene Ontology Go:
- exocytic vesicle
extracellular region
extracellular space
insulin-like growth factor binding protein complex
insulin-like growth factor ternary complex
interstitial matrix
neuronal cell body
plasma membrane
platelet alpha granule lumen
hormone activity
insulin receptor binding
insulin-like growth factor receptor binding
integrin binding
steroid binding
aging
blood coagulation
bone mineralization involved in bone maturation
cell activation
cell proliferation
cellular protein metabolic process
cellular response to electrical stimulus
cellular response to estradiol stimulus
cellular response to insulin stimulus
detection of mechanical stimulus involved in sensory perception
DNA replication
ERK1 and ERK2 cascade
female pregnancy
glycolate metabolic process
insulin-like growth factor receptor signaling pathway
memory
movement of cell or subcellular component
muscle hypertrophy
muscle organ development
myoblast differentiation
myoblast proliferation
myotube cell development
negative regulation of apoptotic process
negative regulation of cholangiocyte apoptotic process
negative regulation of extrinsic apoptotic signaling pathway
negative regulation of neuron death
negative regulation of oocyte development
negative regulation of release of cytochrome c from mitochondria
negative regulation of smooth muscle cell apoptotic process
phosphatidylinositol 3-kinase signaling
phosphatidylinositol-mediated signaling
platelet activation
platelet degranulation
positive regulation of activated T cell proliferation
positive regulation of calcineurin-NFAT signaling cascade
positive regulation of cardiac muscle hypertrophy
positive regulation of cell growth
positive regulation of cell migration
positive regulation of cell proliferation
positive regulation of DNA binding
positive regulation of DNA replication
positive regulation of epithelial cell proliferation
positive regulation of fat cell differentiation
positive regulation of fibroblast proliferation
positive regulation of glucose import
positive regulation of glycogen biosynthetic process
positive regulation of glycolytic process
positive regulation of glycoprotein biosynthetic process
positive regulation of insulin-like growth factor receptor signaling pathway
positive regulation of MAPK cascade
positive regulation of mitotic nuclear division
positive regulation of osteoblast differentiation
positive regulation of peptidyl-tyrosine phosphorylation
positive regulation of phosphatidylinositol 3-kinase signaling
positive regulation of protein import into nucleus, translocation
positive regulation of protein secretion
positive regulation of Ras protein signal transduction
positive regulation of smooth muscle cell migration
positive regulation of smooth muscle cell proliferation
positive regulation of transcription from RNA polymerase II promoter
positive regulation of transcription regulatory region DNA binding
positive regulation of transcription, DNA-templated
positive regulation of trophectodermal cell proliferation
positive regulation of tyrosine phosphorylation of Stat5 protein
protein kinase B signaling
protein stabilization
proteoglycan biosynthetic process
Ras protein signal transduction
regulation of calcium ion transport
regulation of gene expression
regulation of multicellular organism growth
regulation of translation
response to activity
response to caffeine
response to glucocorticoid
response to heat
response to hypoxia
response to lipopolysaccharide
response to nicotine
response to nutrient
signal transduction
skeletal muscle satellite cell maintenance involved in skeletal muscle regeneration
skeletal system development - Gene Ontology Biological Process:
- aging
blood coagulation
bone mineralization involved in bone maturation
cell activation
cell proliferation
cellular protein metabolic process
cellular response to electrical stimulus
cellular response to estradiol stimulus
cellular response to insulin stimulus
detection of mechanical stimulus involved in sensory perception
DNA replication
ERK1 and ERK2 cascade
female pregnancy
glycolate metabolic process
insulin-like growth factor receptor signaling pathway
memory
movement of cell or subcellular component
muscle hypertrophy
muscle organ development
myoblast differentiation
myoblast proliferation
myotube cell development
negative regulation of apoptotic process
negative regulation of cholangiocyte apoptotic process
negative regulation of extrinsic apoptotic signaling pathway
negative regulation of neuron death
negative regulation of oocyte development
negative regulation of release of cytochrome c from mitochondria
negative regulation of smooth muscle cell apoptotic process
phosphatidylinositol 3-kinase signaling
phosphatidylinositol-mediated signaling
platelet activation
platelet degranulation
positive regulation of activated T cell proliferation
positive regulation of calcineurin-NFAT signaling cascade
positive regulation of cardiac muscle hypertrophy
positive regulation of cell growth
positive regulation of cell migration
positive regulation of cell proliferation
positive regulation of DNA binding
positive regulation of DNA replication
positive regulation of epithelial cell proliferation
positive regulation of fat cell differentiation
positive regulation of fibroblast proliferation
positive regulation of glucose import
positive regulation of glycogen biosynthetic process
positive regulation of glycolytic process
positive regulation of glycoprotein biosynthetic process
positive regulation of insulin-like growth factor receptor signaling pathway
positive regulation of MAPK cascade
positive regulation of mitotic nuclear division
positive regulation of osteoblast differentiation
positive regulation of peptidyl-tyrosine phosphorylation
positive regulation of phosphatidylinositol 3-kinase signaling
positive regulation of protein import into nucleus, translocation
positive regulation of protein secretion
positive regulation of Ras protein signal transduction
positive regulation of smooth muscle cell migration
positive regulation of smooth muscle cell proliferation
positive regulation of transcription, DNA-templated
positive regulation of transcription from RNA polymerase II promoter
positive regulation of transcription regulatory region DNA binding
positive regulation of trophectodermal cell proliferation
positive regulation of tyrosine phosphorylation of Stat5 protein
protein kinase B signaling
protein stabilization
proteoglycan biosynthetic process
Ras protein signal transduction
regulation of calcium ion transport
regulation of gene expression
regulation of multicellular organism growth
regulation of translation
response to activity
response to caffeine
response to glucocorticoid
response to heat
response to hypoxia
response to lipopolysaccharide
response to nicotine
response to nutrient
signal transduction
skeletal muscle satellite cell maintenance involved in skeletal muscle regeneration
skeletal system development - Gene Ontology Molecular Function:
- hormone activity
insulin-like growth factor receptor binding
insulin receptor binding
integrin binding
steroid binding - Gene Ontology Cellular Component:
- exocytic vesicle
extracellular region
extracellular space
insulin-like growth factor binding protein complex
insulin-like growth factor ternary complex
interstitial matrix
neuronal cell body
plasma membrane
platelet alpha granule lumen - Keywords:
- 3D-structure
Alternative splicing
Complete proteome
Deafness
Direct protein sequencing
Disulfide bond
Growth factor
Polymorphism
Reference proteome
Secreted
Signal - Interacts With:
- P08069; P06213