Names & Taxonomy
- Uniprot ID:
- P04271
- Entry Name:
- S100B_HUMAN
- Status:
- reviewed
- Protein Names:
- Protein S100-B (S-100 protein beta chain) (S-100 protein subunit beta) (S100 calcium-binding protein B)
- Gene Names:
- S100B
- Gene Names Primary:
- S100B
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 92
- Sequence:
- MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Cytoplasm
Function
- Function:
- Weakly binds calcium but binds zinc very tightly-distinct binding sites with different affinities exist for both ions on each monomer. Physiological concentrations of potassium ion antagonize the binding of both divalent cations, especially affecting high-affinity calcium-binding sites. Binds to and initiates the activation of STK38 by releasing autoinhibitory intramolecular interactions within the kinase. Interaction with AGER after myocardial infarction may play a role in myocyte apoptosis by activating ERK1/2 and p53/TP53 signaling. Could assist ATAD3A cytoplasmic processing, preventing aggregation and favoring mitochondrial localization. May mediate calcium-dependent regulation on many physiological processes by interacting with other proteins, such as TPR-containing proteins, and modulating their activity.
- Cross Reference Drug Bank:
- DB00768
- Gene Ontology Go:
- cytoplasm
extracellular region
extracellular space
intracellular membrane-bounded organelle
neuronal cell body
nucleus
perinuclear region of cytoplasm
ruffle
calcium ion binding
calcium-dependent protein binding
identical protein binding
protein homodimerization activity
RAGE receptor binding
S100 protein binding
tau protein binding
zinc ion binding
astrocyte differentiation
axonogenesis
cell proliferation
cellular response to hypoxia
central nervous system development
innate immune response
learning or memory
long-term synaptic potentiation
memory
negative regulation of skeletal muscle cell differentiation
positive regulation of apoptotic process
positive regulation of cell proliferation
positive regulation of I-kappaB kinase/NF-kappaB signaling
regulation of cell shape
regulation of neuronal synaptic plasticity
response to glucocorticoid
response to methylmercury - Gene Ontology Biological Process:
- astrocyte differentiation
axonogenesis
cell proliferation
cellular response to hypoxia
central nervous system development
innate immune response
learning or memory
long-term synaptic potentiation
memory
negative regulation of skeletal muscle cell differentiation
positive regulation of apoptotic process
positive regulation of cell proliferation
positive regulation of I-kappaB kinase/NF-kappaB signaling
regulation of cell shape
regulation of neuronal synaptic plasticity
response to glucocorticoid
response to methylmercury - Gene Ontology Molecular Function:
- calcium-dependent protein binding
calcium ion binding
identical protein binding
protein homodimerization activity
RAGE receptor binding
S100 protein binding
tau protein binding
zinc ion binding - Gene Ontology Cellular Component:
- cytoplasm
extracellular region
extracellular space
intracellular membrane-bounded organelle
neuronal cell body
nucleus
perinuclear region of cytoplasm
ruffle - Keywords:
- 3D-structure
Acetylation
Calcium
Complete proteome
Cytoplasm
Direct protein sequencing
Metal-binding
Nucleus
Reference proteome
Repeat
Zinc - Interacts With:
- Itself; Q15109; Q00987; P23297; P31949; P29034; P26447; P06703; P25815; Q9NZD8; P04637