Names & Taxonomy
- Uniprot ID:
- P02778
- Entry Name:
- CXL10_HUMAN
- Status:
- reviewed
- Protein Names:
- C-X-C motif chemokine 10 (10 kDa interferon gamma-induced protein) (Gamma-IP10) (IP-10) (Small-inducible cytokine B10) [Cleaved into: CXCL10(1-73)]
- Gene Names:
- CXCL10 INP10 SCYB10
- Gene Names Primary:
- CXCL10
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 98
- Sequence:
- MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Secreted.
Function
- Function:
- Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3.
- Gene Ontology Go:
- external side of plasma membrane
extracellular region
extracellular space
cAMP-dependent protein kinase regulator activity
chemokine activity
CXCR3 chemokine receptor binding
heparin binding
receptor binding
blood circulation
cell surface receptor signaling pathway
cell-cell signaling
cellular response to heat
cellular response to lipopolysaccharide
chemokine-mediated signaling pathway
chemotaxis
defense response to virus
endothelial cell activation
G-protein coupled receptor signaling pathway
immune response
inflammatory response
muscle organ development
negative regulation of angiogenesis
negative regulation of myoblast differentiation
negative regulation of myoblast fusion
positive regulation of cAMP metabolic process
positive regulation of cAMP-mediated signaling
positive regulation of cell proliferation
positive regulation of monocyte chemotaxis
positive regulation of release of sequestered calcium ion into cytosol
positive regulation of T cell migration
positive regulation of transcription from RNA polymerase II promoter
regulation of cell proliferation
regulation of endothelial tube morphogenesis
regulation of protein kinase activity
regulation of T cell chemotaxis
response to auditory stimulus
response to cold
response to gamma radiation
response to vitamin D
signal transduction
T cell chemotaxis - Gene Ontology Biological Process:
- blood circulation
cell-cell signaling
cell surface receptor signaling pathway
cellular response to heat
cellular response to lipopolysaccharide
chemokine-mediated signaling pathway
chemotaxis
defense response to virus
endothelial cell activation
G-protein coupled receptor signaling pathway
immune response
inflammatory response
muscle organ development
negative regulation of angiogenesis
negative regulation of myoblast differentiation
negative regulation of myoblast fusion
positive regulation of cAMP-mediated signaling
positive regulation of cAMP metabolic process
positive regulation of cell proliferation
positive regulation of monocyte chemotaxis
positive regulation of release of sequestered calcium ion into cytosol
positive regulation of T cell migration
positive regulation of transcription from RNA polymerase II promoter
regulation of cell proliferation
regulation of endothelial tube morphogenesis
regulation of protein kinase activity
regulation of T cell chemotaxis
response to auditory stimulus
response to cold
response to gamma radiation
response to vitamin D
signal transduction
T cell chemotaxis - Gene Ontology Molecular Function:
- cAMP-dependent protein kinase regulator activity
chemokine activity
CXCR3 chemokine receptor binding
heparin binding
receptor binding - Gene Ontology Cellular Component:
- external side of plasma membrane
extracellular region
extracellular space - Keywords:
- 3D-structure
Chemotaxis
Citrullination
Complete proteome
Cytokine
Direct protein sequencing
Disulfide bond
Inflammatory response
Reference proteome
Secreted
Signal - Interacts With:
- P27487