Names & Taxonomy
- Uniprot ID:
- P01584
- Entry Name:
- IL1B_HUMAN
- Status:
- reviewed
- Protein Names:
- Interleukin-1 beta (IL-1 beta) (Catabolin)
- Gene Names:
- IL1B IL1F2
- Gene Names Primary:
- IL1B
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 269
- Sequence:
- MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Cytoplasm, cytosol
Function
- Function:
- Potent proinflammatory cytokine. Initially discovered as the major endogenous pyrogen, induces prostaglandin synthesis, neutrophil influx and activation, T-cell activation and cytokine production, B-cell activation and antibody production, and fibroblast proliferation and collagen production. Promotes Th17 differentiation of T-cells.
- Cross Reference Drug Bank:
- DB06168 DB05260 DB01017 DB06372
- Gene Ontology Go:
- autophagosome
cytosol
extracellular exosome
extracellular region
extracellular space
lysosome
secretory granule
cytokine activity
interleukin-1 receptor binding
protein domain specific binding
activation of MAPK activity
aging
apoptotic process
cell-cell signaling
cellular response to antibiotic
cellular response to drug
cellular response to fatty acid
cellular response to glucose stimulus
cellular response to mechanical stimulus
cellular response to methotrexate
cellular response to organic cyclic compound
cellular response to organic substance
chronic inflammatory response to antigenic stimulus
cytokine-mediated signaling pathway
ectopic germ cell programmed cell death
embryo implantation
estrogen metabolic process
extrinsic apoptotic signaling pathway in absence of ligand
fever generation
glycoprotein metabolic process
hyaluronan biosynthetic process
inflammatory response
inflammatory response to antigenic stimulus
innate immune response
interleukin-1 beta production
lipopolysaccharide-mediated signaling pathway
MAPK cascade
memory
monocyte aggregation
negative regulation of adiponectin secretion
negative regulation of branching morphogenesis of a nerve
negative regulation of cell proliferation
negative regulation of extrinsic apoptotic signaling pathway in absence of ligand
negative regulation of glucose transport
negative regulation of glutamate secretion
negative regulation of insulin receptor signaling pathway
negative regulation of lipid catabolic process
negative regulation of lipid metabolic process
negative regulation of MAP kinase activity
negative regulation of neural precursor cell proliferation
negative regulation of neuron differentiation
negative regulation of transcription from RNA polymerase II promoter
neutrophil chemotaxis
ovulation
pentacyclic triterpenoid metabolic process
polyketide metabolic process
positive regulation of angiogenesis
positive regulation of apoptotic process
positive regulation of astrocyte differentiation
positive regulation of calcidiol 1-monooxygenase activity
positive regulation of cell adhesion molecule production
positive regulation of chemokine biosynthetic process
positive regulation of cytosolic calcium ion concentration
positive regulation of ERK1 and ERK2 cascade
positive regulation of fever generation
positive regulation of gene expression
positive regulation of granulocyte macrophage colony-stimulating factor production
positive regulation of heterotypic cell-cell adhesion
positive regulation of histone acetylation
positive regulation of histone phosphorylation
positive regulation of immature T cell proliferation in thymus
positive regulation of interferon-gamma production
positive regulation of interleukin-2 biosynthetic process
positive regulation of interleukin-6 biosynthetic process
positive regulation of interleukin-6 production
positive regulation of interleukin-6 secretion
positive regulation of interleukin-8 production
positive regulation of JUN kinase activity
positive regulation of lipid catabolic process
positive regulation of membrane protein ectodomain proteolysis
positive regulation of mitotic nuclear division
positive regulation of monocyte chemotactic protein-1 production
positive regulation of myosin light chain kinase activity
positive regulation of neutrophil chemotaxis
positive regulation of NF-kappaB import into nucleus
positive regulation of NF-kappaB transcription factor activity
positive regulation of nitric oxide biosynthetic process
positive regulation of phagocytosis
positive regulation of prostaglandin secretion
positive regulation of protein export from nucleus
positive regulation of protein phosphorylation
positive regulation of sequence-specific DNA binding transcription factor activity
positive regulation of T cell mediated immunity
positive regulation of T cell proliferation
positive regulation of transcription from RNA polymerase II promoter
positive regulation of transcription, DNA-templated
positive regulation of vascular endothelial growth factor production
positive regulation of vascular endothelial growth factor receptor signaling pathway
protein kinase B signaling
purine nucleobase metabolic process
regulation of establishment of endothelial barrier
regulation of I-kappaB kinase/NF-kappaB signaling
regulation of insulin secretion
regulation of nitric-oxide synthase activity
response to ATP
response to dexamethasone
response to diuretic
response to estradiol
response to ethanol
response to gamma radiation
response to heat
response to hypoxia
response to L-ascorbic acid
response to morphine
response to ozone
response to peptide hormone
response to statin
response to stilbenoid
response to vitamin D
sequestering of triglyceride
signal transduction
smooth muscle adaptation
social behavior
stimulatory C-type lectin receptor signaling pathway
wound healing - Gene Ontology Biological Process:
- activation of MAPK activity
aging
apoptotic process
cell-cell signaling
cellular response to antibiotic
cellular response to drug
cellular response to fatty acid
cellular response to glucose stimulus
cellular response to mechanical stimulus
cellular response to methotrexate
cellular response to organic cyclic compound
cellular response to organic substance
chronic inflammatory response to antigenic stimulus
cytokine-mediated signaling pathway
ectopic germ cell programmed cell death
embryo implantation
estrogen metabolic process
extrinsic apoptotic signaling pathway in absence of ligand
fever generation
glycoprotein metabolic process
hyaluronan biosynthetic process
inflammatory response
inflammatory response to antigenic stimulus
innate immune response
interleukin-1 beta production
lipopolysaccharide-mediated signaling pathway
MAPK cascade
memory
monocyte aggregation
negative regulation of adiponectin secretion
negative regulation of branching morphogenesis of a nerve
negative regulation of cell proliferation
negative regulation of extrinsic apoptotic signaling pathway in absence of ligand
negative regulation of glucose transport
negative regulation of glutamate secretion
negative regulation of insulin receptor signaling pathway
negative regulation of lipid catabolic process
negative regulation of lipid metabolic process
negative regulation of MAP kinase activity
negative regulation of neural precursor cell proliferation
negative regulation of neuron differentiation
negative regulation of transcription from RNA polymerase II promoter
neutrophil chemotaxis
ovulation
pentacyclic triterpenoid metabolic process
polyketide metabolic process
positive regulation of angiogenesis
positive regulation of apoptotic process
positive regulation of astrocyte differentiation
positive regulation of calcidiol 1-monooxygenase activity
positive regulation of cell adhesion molecule production
positive regulation of chemokine biosynthetic process
positive regulation of cytosolic calcium ion concentration
positive regulation of ERK1 and ERK2 cascade
positive regulation of fever generation
positive regulation of gene expression
positive regulation of granulocyte macrophage colony-stimulating factor production
positive regulation of heterotypic cell-cell adhesion
positive regulation of histone acetylation
positive regulation of histone phosphorylation
positive regulation of immature T cell proliferation in thymus
positive regulation of interferon-gamma production
positive regulation of interleukin-2 biosynthetic process
positive regulation of interleukin-6 biosynthetic process
positive regulation of interleukin-6 production
positive regulation of interleukin-6 secretion
positive regulation of interleukin-8 production
positive regulation of JUN kinase activity
positive regulation of lipid catabolic process
positive regulation of membrane protein ectodomain proteolysis
positive regulation of mitotic nuclear division
positive regulation of monocyte chemotactic protein-1 production
positive regulation of myosin light chain kinase activity
positive regulation of neutrophil chemotaxis
positive regulation of NF-kappaB import into nucleus
positive regulation of NF-kappaB transcription factor activity
positive regulation of nitric oxide biosynthetic process
positive regulation of phagocytosis
positive regulation of prostaglandin secretion
positive regulation of protein export from nucleus
positive regulation of protein phosphorylation
positive regulation of sequence-specific DNA binding transcription factor activity
positive regulation of T cell mediated immunity
positive regulation of T cell proliferation
positive regulation of transcription, DNA-templated
positive regulation of transcription from RNA polymerase II promoter
positive regulation of vascular endothelial growth factor production
positive regulation of vascular endothelial growth factor receptor signaling pathway
protein kinase B signaling
purine nucleobase metabolic process
regulation of establishment of endothelial barrier
regulation of I-kappaB kinase/NF-kappaB signaling
regulation of insulin secretion
regulation of nitric-oxide synthase activity
response to ATP
response to dexamethasone
response to diuretic
response to estradiol
response to ethanol
response to gamma radiation
response to heat
response to hypoxia
response to L-ascorbic acid
response to morphine
response to ozone
response to peptide hormone
response to statin
response to stilbenoid
response to vitamin D
sequestering of triglyceride
signal transduction
smooth muscle adaptation
social behavior
stimulatory C-type lectin receptor signaling pathway
wound healing - Gene Ontology Molecular Function:
- cytokine activity
interleukin-1 receptor binding
protein domain specific binding - Gene Ontology Cellular Component:
- autophagosome
cytosol
extracellular exosome
extracellular region
extracellular space
lysosome
secretory granule - Keywords:
- 3D-structure
Complete proteome
Cytokine
Cytoplasm
Cytoplasmic vesicle
Direct protein sequencing
Inflammatory response
Lysosome
Mitogen
Polymorphism
Pyrogen
Reference proteome
Secreted