Names & Taxonomy
- Uniprot ID:
- P01579
- Entry Name:
- IFNG_HUMAN
- Status:
- reviewed
- Protein Names:
- Interferon gamma (IFN-gamma) (Immune interferon)
- Gene Names:
- IFNG
- Gene Names Primary:
- IFNG
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 166
- Sequence:
- MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Secreted.
Function
- Function:
- Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons.
- Cross Reference Drug Bank:
- DB05676 DB01296 DB01250
- Gene Ontology Go:
- external side of plasma membrane
extracellular region
extracellular space
intracellular
cytokine activity
interferon-gamma receptor binding
adaptive immune response
antigen processing and presentation
apoptotic process
CD8-positive, alpha-beta T cell differentiation involved in immune response
cell cycle arrest
cell surface receptor signaling pathway
cellular response to interleukin-18
cellular response to lipopolysaccharide
cytokine-mediated signaling pathway
defense response to bacterium
defense response to protozoan
defense response to virus
endoplasmic reticulum unfolded protein response
extrinsic apoptotic signaling pathway
humoral immune response
interferon-gamma-mediated signaling pathway
movement of cell or subcellular component
negative regulation of epithelial cell differentiation
negative regulation of gene expression
negative regulation of growth of symbiont in host
negative regulation of interleukin-17 production
negative regulation of myelination
negative regulation of smooth muscle cell proliferation
negative regulation of transcription from RNA polymerase II promoter
neutrophil apoptotic process
neutrophil chemotaxis
positive regulation of autophagy
positive regulation of calcidiol 1-monooxygenase activity
positive regulation of CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation involved in immune response
positive regulation of cell proliferation
positive regulation of chemokine biosynthetic process
positive regulation of epithelial cell migration
positive regulation of establishment of protein localization to plasma membrane
positive regulation of exosomal secretion
positive regulation of fructose 1,6-bisphosphate 1-phosphatase activity
positive regulation of fructose 1,6-bisphosphate metabolic process
positive regulation of gene expression
positive regulation of interleukin-1 beta secretion
positive regulation of interleukin-12 biosynthetic process
positive regulation of interleukin-12 production
positive regulation of interleukin-23 production
positive regulation of interleukin-6 biosynthetic process
positive regulation of isotype switching to IgG isotypes
positive regulation of killing of cells of other organism
positive regulation of membrane protein ectodomain proteolysis
positive regulation of MHC class II biosynthetic process
positive regulation of neuron differentiation
positive regulation of nitric oxide biosynthetic process
positive regulation of osteoclast differentiation
positive regulation of peptidyl-serine phosphorylation of STAT protein
positive regulation of smooth muscle cell apoptotic process
positive regulation of synaptic transmission, cholinergic
positive regulation of T cell proliferation
positive regulation of transcription from RNA polymerase II promoter
positive regulation of tumor necrosis factor (ligand) superfamily member 11 production
positive regulation of tumor necrosis factor production
positive regulation of tyrosine phosphorylation of Stat1 protein
positive regulation of vitamin D biosynthetic process
protein import into nucleus, translocation
regulation of hepatocyte proliferation
regulation of insulin secretion
regulation of interferon-gamma-mediated signaling pathway
regulation of neuronal action potential
regulation of the force of heart contraction
response to drug
response to virus
sensory perception of mechanical stimulus
T cell receptor signaling pathway - Gene Ontology Biological Process:
- adaptive immune response
antigen processing and presentation
apoptotic process
CD8-positive, alpha-beta T cell differentiation involved in immune response
cell cycle arrest
cell surface receptor signaling pathway
cellular response to interleukin-18
cellular response to lipopolysaccharide
cytokine-mediated signaling pathway
defense response to bacterium
defense response to protozoan
defense response to virus
endoplasmic reticulum unfolded protein response
extrinsic apoptotic signaling pathway
humoral immune response
interferon-gamma-mediated signaling pathway
movement of cell or subcellular component
negative regulation of epithelial cell differentiation
negative regulation of gene expression
negative regulation of growth of symbiont in host
negative regulation of interleukin-17 production
negative regulation of myelination
negative regulation of smooth muscle cell proliferation
negative regulation of transcription from RNA polymerase II promoter
neutrophil apoptotic process
neutrophil chemotaxis
positive regulation of autophagy
positive regulation of calcidiol 1-monooxygenase activity
positive regulation of CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation involved in immune response
positive regulation of cell proliferation
positive regulation of chemokine biosynthetic process
positive regulation of epithelial cell migration
positive regulation of establishment of protein localization to plasma membrane
positive regulation of exosomal secretion
positive regulation of fructose 1,6-bisphosphate 1-phosphatase activity
positive regulation of fructose 1,6-bisphosphate metabolic process
positive regulation of gene expression
positive regulation of interleukin-12 biosynthetic process
positive regulation of interleukin-12 production
positive regulation of interleukin-1 beta secretion
positive regulation of interleukin-23 production
positive regulation of interleukin-6 biosynthetic process
positive regulation of isotype switching to IgG isotypes
positive regulation of killing of cells of other organism
positive regulation of membrane protein ectodomain proteolysis
positive regulation of MHC class II biosynthetic process
positive regulation of neuron differentiation
positive regulation of nitric oxide biosynthetic process
positive regulation of osteoclast differentiation
positive regulation of peptidyl-serine phosphorylation of STAT protein
positive regulation of smooth muscle cell apoptotic process
positive regulation of synaptic transmission, cholinergic
positive regulation of T cell proliferation
positive regulation of transcription from RNA polymerase II promoter
positive regulation of tumor necrosis factor (ligand) superfamily member 11 production
positive regulation of tumor necrosis factor production
positive regulation of tyrosine phosphorylation of Stat1 protein
positive regulation of vitamin D biosynthetic process
protein import into nucleus, translocation
regulation of hepatocyte proliferation
regulation of insulin secretion
regulation of interferon-gamma-mediated signaling pathway
regulation of neuronal action potential
regulation of the force of heart contraction
response to drug
response to virus
sensory perception of mechanical stimulus
T cell receptor signaling pathway - Gene Ontology Molecular Function:
- cytokine activity
interferon-gamma receptor binding - Gene Ontology Cellular Component:
- external side of plasma membrane
extracellular region
extracellular space
intracellular - Keywords:
- 3D-structure
Antiviral defense
Cleavage on pair of basic residues
Complete proteome
Cytokine
Direct protein sequencing
Glycoprotein
Growth regulation
Pharmaceutical
Polymorphism
Pyrrolidone carboxylic acid
Reference proteome
Secreted
Signal