Names & Taxonomy
- Uniprot ID:
- P01270
- Entry Name:
- PTHY_HUMAN
- Status:
- reviewed
- Protein Names:
- Parathyroid hormone (PTH) (Parathormone) (Parathyrin)
- Gene Names:
- PTH
- Gene Names Primary:
- PTH
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 115
- Sequence:
- MIPAKDMAKVMIVMLAICFLTKSDGKSVKKRSVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Secreted.
Function
- Function:
- PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates -2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblastic cells.
- Gene Ontology Go:
- extracellular region
extracellular space
intracellular
hormone activity
parathyroid hormone receptor binding
peptide hormone receptor binding
transcription factor activity, RNA polymerase II distal enhancer sequence-specific binding
adenylate cyclase-activating G-protein coupled receptor signaling pathway
bone resorption
cAMP metabolic process
cell-cell signaling
cellular calcium ion homeostasis
cellular macromolecule biosynthetic process
G-protein coupled receptor signaling pathway
homeostasis of number of cells within a tissue
hormone-mediated apoptotic signaling pathway
negative regulation of apoptotic process in bone marrow
negative regulation of transcription from RNA polymerase II promoter
positive regulation of bone mineralization
positive regulation of cAMP biosynthetic process
positive regulation of cell proliferation in bone marrow
positive regulation of glucose import
positive regulation of glycogen biosynthetic process
positive regulation of osteoclast proliferation
positive regulation of signal transduction
positive regulation of transcription from RNA polymerase II promoter
regulation of gene expression
response to cadmium ion
response to drug
response to ethanol
response to fibroblast growth factor
response to lead ion
response to parathyroid hormone
response to vitamin D
Rho protein signal transduction
skeletal system development - Gene Ontology Biological Process:
- adenylate cyclase-activating G-protein coupled receptor signaling pathway
bone resorption
cAMP metabolic process
cell-cell signaling
cellular calcium ion homeostasis
cellular macromolecule biosynthetic process
G-protein coupled receptor signaling pathway
homeostasis of number of cells within a tissue
hormone-mediated apoptotic signaling pathway
negative regulation of apoptotic process in bone marrow
negative regulation of transcription from RNA polymerase II promoter
positive regulation of bone mineralization
positive regulation of cAMP biosynthetic process
positive regulation of cell proliferation in bone marrow
positive regulation of glucose import
positive regulation of glycogen biosynthetic process
positive regulation of osteoclast proliferation
positive regulation of signal transduction
positive regulation of transcription from RNA polymerase II promoter
regulation of gene expression
response to cadmium ion
response to drug
response to ethanol
response to fibroblast growth factor
response to lead ion
response to parathyroid hormone
response to vitamin D
Rho protein signal transduction
skeletal system development - Gene Ontology Molecular Function:
- hormone activity
parathyroid hormone receptor binding
peptide hormone receptor binding
transcription factor activity, RNA polymerase II distal enhancer sequence-specific binding - Gene Ontology Cellular Component:
- extracellular region
extracellular space
intracellular - Keywords:
- 3D-structure
Cleavage on pair of basic residues
Complete proteome
Direct protein sequencing
Disease mutation
Hormone
Reference proteome
Secreted
Signal