Names & Taxonomy
- Uniprot ID:
- P00492
- Entry Name:
- HPRT_HUMAN
- Status:
- reviewed
- Protein Names:
- Hypoxanthine-guanine phosphoribosyltransferase (HGPRT) (HGPRTase) (EC 2.4.2.8)
- Gene Names:
- HPRT1 HPRT
- Gene Names Primary:
- HPRT1
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 218
- Sequence:
- MATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Cytoplasm.
Function
- Function:
- Converts guanine to guanosine monophosphate, and hypoxanthine to inosine monophosphate. Transfers the 5-phosphoribosyl group from 5-phosphoribosylpyrophosphate onto the purine. Plays a central role in the generation of purine nucleotides through the purine salvage pathway.
- Pathway:
- Purine metabolism; IMP biosynthesis via salvage pathway; IMP from hypoxanthine: step 1/1.
- Catalytic Activity:
- IMP + diphosphate = hypoxanthine + 5-phospho-alpha-D-ribose 1-diphosphate.; GMP + diphosphate = guanine + 5-phospho-alpha-D-ribose 1-diphosphate.
- Cofactor:
- COFACTOR: Name=Mg(2+); Xref=ChEBI:CHEBI:18420; ; Note=Binds 2 magnesium ions per subunit. The magnesium ions are essentially bound to the substrate and have few direct interactions with the protein.;
- Kinetics:
- BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=5.4 uM for IMP
- Active Site:
- ACT_SITE 138 138 Proton acceptor.
- Cross Reference Drug Bank:
- DB00993 DB01033 DB00352
- Gene Ontology Go:
- cytoplasm
cytosol
extracellular exosome
guanine phosphoribosyltransferase activity
hypoxanthine phosphoribosyltransferase activity
magnesium ion binding
nucleotide binding
protein homodimerization activity
adenine salvage
central nervous system neuron development
cerebral cortex neuron differentiation
cytolysis
dendrite morphogenesis
dopamine metabolic process
GMP catabolic process
GMP salvage
grooming behavior
guanine salvage
hypoxanthine metabolic process
hypoxanthine salvage
IMP metabolic process
IMP salvage
locomotory behavior
lymphocyte proliferation
nucleobase-containing small molecule metabolic process
positive regulation of dopamine metabolic process
protein homotetramerization
purine nucleobase metabolic process
purine nucleotide biosynthetic process
purine ribonucleoside salvage
purine-containing compound salvage
response to amphetamine
small molecule metabolic process
striatum development - Gene Ontology Biological Process:
- adenine salvage
central nervous system neuron development
cerebral cortex neuron differentiation
cytolysis
dendrite morphogenesis
dopamine metabolic process
GMP catabolic process
GMP salvage
grooming behavior
guanine salvage
hypoxanthine metabolic process
hypoxanthine salvage
IMP metabolic process
IMP salvage
locomotory behavior
lymphocyte proliferation
nucleobase-containing small molecule metabolic process
positive regulation of dopamine metabolic process
protein homotetramerization
purine-containing compound salvage
purine nucleobase metabolic process
purine nucleotide biosynthetic process
purine ribonucleoside salvage
response to amphetamine
small molecule metabolic process
striatum development - Gene Ontology Molecular Function:
- guanine phosphoribosyltransferase activity
hypoxanthine phosphoribosyltransferase activity
magnesium ion binding
nucleotide binding
protein homodimerization activity - Gene Ontology Cellular Component:
- cytoplasm
cytosol
extracellular exosome - Keywords:
- 3D-structure
Acetylation
Complete proteome
Cytoplasm
Direct protein sequencing
Disease mutation
Glycosyltransferase
Gout
Magnesium
Metal-binding
Nucleotide-binding
Phosphoprotein
Purine salvage
Reference proteome
Transferase - Interacts With:
- Q9H1K1; Q9NRG1; O00560; Q96HA8
Publication
- PubMed ID:
- 6300847 2341149 14702039 15772651 15489334 7107641 3023844 21269460 24275569 25944712 8044844 10360366 10338013 1487231 15990111 19527031 6853490 6853716 6572373 6706936 3358423 3384338 3265398 2896620 3198771 3148064 2572141 2909537 2910902 2738157 2928313 2347587 2358296 2246854 2018042 2071157 1937471 1840476 1551676 1301916 7987318 7627191 9003484 9452051 15571223 17027311 20544509 24940672