Names & Taxonomy
- Uniprot ID:
- O60895
- Entry Name:
- RAMP2_HUMAN
- Status:
- reviewed
- Protein Names:
- Receptor activity-modifying protein 2 (Calcitonin-receptor-like receptor activity-modifying protein 2) (CRLR activity-modifying protein 2)
- Gene Names:
- RAMP2
- Gene Names Primary:
- RAMP2
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 175
- Sequence:
- MASLRVERAGGPRLPRTRVGRPAALRLLLLLGAVLNPHEALAQPLPTTGTPGSEGGTVKNYETAVQFCWNHYKDQMDPIEKDWCDWAMISRPYSTLRDCLEHFAELFDLGFPNPLAERIIFETHQIHFANCSLVQPTFSDPPEDVLLAMIIAPICLIPFLITLVVWRSKDSEAQA
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Membrane; Single-pass type I membrane protein.
Function
- Function:
- Transports the calcitonin gene-related peptide type 1 receptor (CALCRL) to the plasma membrane. Acts as a receptor for adrenomedullin (AM) together with CALCRL.
- Cross Reference Drug Bank:
- DB01278
- Gene Ontology Go:
- cell surface
coated pit
cytoplasm
integral component of plasma membrane
lysosome
plasma membrane
receptor complex
coreceptor activity
protein transporter activity
adherens junction assembly
angiogenesis
basement membrane assembly
bicellular tight junction assembly
calcium ion transport
cAMP biosynthetic process
cellular response to hormone stimulus
cellular response to vascular endothelial growth factor stimulus
female pregnancy
G-protein coupled receptor signaling pathway
heart development
intracellular protein transport
negative regulation of endothelial cell apoptotic process
negative regulation of vascular permeability
positive regulation of angiogenesis
positive regulation of cAMP biosynthetic process
positive regulation of gene expression
positive regulation of vasculogenesis
protein localization to plasma membrane
protein transport
receptor internalization
regulation of blood pressure
regulation of G-protein coupled receptor protein signaling pathway
response to estradiol
response to hypoxia
response to progesterone
sprouting angiogenesis
vascular smooth muscle cell development
vasculogenesis - Gene Ontology Biological Process:
- adherens junction assembly
angiogenesis
basement membrane assembly
bicellular tight junction assembly
calcium ion transport
cAMP biosynthetic process
cellular response to hormone stimulus
cellular response to vascular endothelial growth factor stimulus
female pregnancy
G-protein coupled receptor signaling pathway
heart development
intracellular protein transport
negative regulation of endothelial cell apoptotic process
negative regulation of vascular permeability
positive regulation of angiogenesis
positive regulation of cAMP biosynthetic process
positive regulation of gene expression
positive regulation of vasculogenesis
protein localization to plasma membrane
protein transport
receptor internalization
regulation of blood pressure
regulation of G-protein coupled receptor protein signaling pathway
response to estradiol
response to hypoxia
response to progesterone
sprouting angiogenesis
vascular smooth muscle cell development
vasculogenesis - Gene Ontology Molecular Function:
- coreceptor activity
protein transporter activity - Gene Ontology Cellular Component:
- cell surface
coated pit
cytoplasm
integral component of plasma membrane
lysosome
plasma membrane
receptor complex - Keywords:
- 3D-structure
Alternative splicing
Complete proteome
Disulfide bond
Glycoprotein
Membrane
Receptor
Reference proteome
Signal
Transmembrane
Transmembrane helix
Transport - Interacts With:
- Q16602