Names & Taxonomy
- Uniprot ID:
- O43315
- Entry Name:
- AQP9_HUMAN
- Status:
- reviewed
- Protein Names:
- Aquaporin-9 (AQP-9) (Aquaglyceroporin-9) (Small solute channel 1)
- Gene Names:
- AQP9 SSC1
- Gene Names Primary:
- AQP9
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 295
- Sequence:
- MQPEGAEKGKSFKQRLVLKSSLAKETLSEFLGTFILIVLGCGCVAQAILSRGRFGGVITINVGFSMAVAMAIYVAGGVSGGHINPAVSLAMCLFGRMKWFKLPFYVGAQFLGAFVGAATVFGIYYDGLMSFAGGKLLIVGENATAHIFATYPAPYLSLANAFADQVVATMILLIIVFAIFDSRNLGAPRGLEPIAIGLLIIVIASSLGLNSGCAMNPARDLSPRLFTALAGWGFEVFRAGNNFWWIPVVGPLVGAVIGGLIYVLVIEIHHPEPDSVFKTEQSEDKPEKYELSVIM
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Membrane; Multi-pass membrane protein.
Function
- Function:
- Forms a channel with a broad specificity. Mediates passage of a wide variety of non-charged solutes including carbamides, polyols, purines, and pyrimidines in a phloretin- and mercury-sensitive manner, whereas amino acids, cyclic sugars, Na(+), K(+), Cl(-), and deprotonated monocarboxylates are excluded. Also permeable to urea and glycerol.
- Gene Ontology Go:
- basolateral plasma membrane
integral component of membrane
integral component of plasma membrane
intracellular membrane-bounded organelle
plasma membrane
amine transmembrane transporter activity
carboxylic acid transmembrane transporter activity
glycerol channel activity
polyol transmembrane transporter activity
porin activity
purine nucleobase transmembrane transporter activity
pyrimidine nucleobase transmembrane transporter activity
urea transmembrane transporter activity
water channel activity
water transmembrane transporter activity
amine transport
canalicular bile acid transport
carboxylic acid transmembrane transport
carboxylic acid transport
cellular response to cAMP
excretion
glycerol transport
immune response
metabolic process
polyol transport
purine nucleobase transmembrane transport
purine nucleobase transport
pyrimidine nucleobase transport
pyrimidine-containing compound transmembrane transport
response to mercury ion
response to organic substance
response to osmotic stress
transmembrane transport
transport
urea transmembrane transport
water homeostasis
water transport - Gene Ontology Biological Process:
- amine transport
canalicular bile acid transport
carboxylic acid transmembrane transport
carboxylic acid transport
cellular response to cAMP
excretion
glycerol transport
immune response
metabolic process
polyol transport
purine nucleobase transmembrane transport
purine nucleobase transport
pyrimidine-containing compound transmembrane transport
pyrimidine nucleobase transport
response to mercury ion
response to organic substance
response to osmotic stress
transmembrane transport
transport
urea transmembrane transport
water homeostasis
water transport - Gene Ontology Molecular Function:
- amine transmembrane transporter activity
carboxylic acid transmembrane transporter activity
glycerol channel activity
polyol transmembrane transporter activity
porin activity
purine nucleobase transmembrane transporter activity
pyrimidine nucleobase transmembrane transporter activity
urea transmembrane transporter activity
water channel activity
water transmembrane transporter activity - Gene Ontology Cellular Component:
- basolateral plasma membrane
integral component of membrane
integral component of plasma membrane
intracellular membrane-bounded organelle
plasma membrane - Keywords:
- Complete proteome
Membrane
Polymorphism
Reference proteome
Repeat
Transmembrane
Transmembrane helix
Transport